DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG31388

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:397 Identity:96/397 - (24%)
Similarity:156/397 - (39%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LQLQDQ----HQQEQQQFVSYQLA-IQQHQKQQQQQQHESITNAAPTAAP---SAQRIKTE--PV 171
            |||.|:    ...|.|...:.:|| |:.....:....::|:  |:|.::|   :..::..|  .:
  Fly   111 LQLNDRMDFIFDPEPQDKNTDELASIKTTTTTEYMNAYQSV--ASPQSSPELSTDSQLSNEHFDM 173

  Fly   172 GGFPASAAVVSQV--RKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAA 234
            |..|.|......:  |..|:|   ..|.:||:.|    .:....|.|.                 
  Fly   174 GLSPESEPESEAIDNRDTSSS---HTCSKCGLEF----ENVDELKLHK----------------- 214

  Fly   235 PVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYR------TH 293
                  ..|:|      ||  |..|           :.|:.|.:.|...|.|.||..      ||
  Fly   215 ------YHLHD------IP--PDTK-----------FVCDHCDEGFRSAAALTRHCNMINLPLTH 254

  Fly   294 TGERPFECEFCHKLFSVKENLQVHRR--IHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHK 356
            :      |..|...|.....|:.|::  :......:.|.:||:....:..|..|:..|.|.|.||
  Fly   255 S------CTKCKSQFHNHILLETHKQRCLRPPASQHVCHICGKHLTTAFNLKNHLVRHAGTRRHK 313

  Fly   357 CSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTH--TGEKPYHCDICF 419
            |..|..:|..:.:|..|.:|||.|:||.| ...|||.|.......:|.|.|  ..::.|.|:.|.
  Fly   314 CDQCSASFYTAAELCSHQKTHTTERPYIC-RYNCGKTFRFCSARSMHERVHMDASKRIYQCEYCP 377

  Fly   420 RDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAASTS 484
            :.:......:.|:..|..::.:.|.||..:||..|...:|:|.:|::.    .||.|.:||:..|
  Fly   378 KSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYRSHLKSNAHKT----LEARAKAAASPNS 438

  Fly   485 AGSSAGS 491
            .|.:..:
  Fly   439 RGRNCST 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
COG5048 <270..420 CDD:227381 46/159 (29%)
zf-C2H2 271..293 CDD:278523 7/27 (26%)
C2H2 Zn finger 273..293 CDD:275368 7/25 (28%)
zf-H2C2_2 286..309 CDD:290200 7/28 (25%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
zf-H2C2_2 313..338 CDD:290200 5/26 (19%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 344..366 CDD:290200 9/21 (43%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 370..396 CDD:290200 13/25 (52%)
C2H2 Zn finger 385..407 CDD:275368 7/21 (33%)
zf-H2C2_2 400..424 CDD:290200 6/25 (24%)
C2H2 Zn finger 415..435 CDD:275368 3/19 (16%)
zf-C2H2 441..463 CDD:278523 8/21 (38%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071
C2H2 Zn finger 228..254 CDD:275368 7/25 (28%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 7/21 (33%)
C2H2 Zn finger 373..393 CDD:275368 3/19 (16%)
C2H2 Zn finger 401..419 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.