DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG14655

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:514 Identity:120/514 - (23%)
Similarity:178/514 - (34%) Gaps:153/514 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 HQKQQQQQQHESITNAAP-------TAAP---SAQRIKTEPVGGFPASAAVVSQVRKPSASKPQF 194
            |.....|:.:||..|..|       .|||   .|:|.:::||...|          .|..:.|..
  Fly    58 HTSLMAQEGNESPANGQPASSRGFLAAAPPKRRAKRTRSKPVVPTP----------PPVRTTPPA 112

  Fly   195 KCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIK 259
            .||.|..:|.:......|.:...:|.:                             |.||.   |
  Fly   113 HCDICEFSFRNTELRDMHVRLVHENAE-----------------------------GEPKQ---K 145

  Fly   260 PLANVAAGADPYQCNVCQKTFAVPARL-------------------------------------- 286
            .........:||:|::|.|||.:...|                                      
  Fly   146 EPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAVTATP 210

  Fly   287 -------IRHYR----------THTGERPF--------------------------ECEFCHKLF 308
                   |||..          |.|..:|:                          ||:.|.|.|
  Fly   211 KLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSMLQQSPSSPESGTATPKLWECDVCSKSF 275

  Fly   309 SVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIH 373
            :.|..|:.|:|:||.|.||.|::|.|.|......|:|:..|:..:||.|.||.:.|.:...|..|
  Fly   276 TTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNH 340

  Fly   374 MRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGS 438
            .|.|:||||:||..  |||.|.......||:|.|||..||.|::|.:.|.|....:.||      
  Fly   341 QRIHSGEKPFKCEV--CGKCFRQRVSFLVHTRIHTGVMPYKCELCQKTFRYKVSQRTHR------ 397

  Fly   439 KCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAASTSAGSSAGSPSLQGVSSNS-- 501
                |. .:|....::.::|.::|:     |...:.:.|||..:....||...|..:.:.|.|  
  Fly   398 ----CP-TEEAQTPEQLIKAFLEGN-----DSHTQPSPASAEIAAINSSSIVDPEQEALLSQSID 452

  Fly   502 ESSNHSPPSSPPATKKPRQARQPRVSKTVAATLSIPTSSPLSPSSLSSTYSPSASSMAS 560
            :..............:||:..|....:.||........|||........|||..:.:.|
  Fly   453 DIVVEQCQKLGICGVEPREEGQLISLQPVAVVHFSGNGSPLQQLQNLRIYSPQQTELPS 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
COG5048 <270..420 CDD:227381 65/230 (28%)
zf-C2H2 271..293 CDD:278523 10/76 (13%)
C2H2 Zn finger 273..293 CDD:275368 9/74 (12%)
zf-H2C2_2 286..309 CDD:290200 11/103 (11%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 12/24 (50%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 8/21 (38%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 370..396 CDD:290200 14/25 (56%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 3/21 (14%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
zf-H2C2_2 281..304 CDD:290200 11/22 (50%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 13/23 (57%)
C2H2 Zn finger 352..372 CDD:275368 8/21 (38%)
zf-H2C2_2 364..389 CDD:290200 11/24 (46%)
C2H2 Zn finger 380..396 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.