DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG17359

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:400 Identity:104/400 - (26%)
Similarity:151/400 - (37%) Gaps:108/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLDISKSPAKAVAVKKSPAKDSATTKMVYYSANQLLIKTEQSSQAQFCLQVPPPLTAT--TTSVG 91
            ||||...|                    |.|:|:              :|...|:.||  ....|
  Fly    17 LLDIYTEP--------------------YASSNR--------------VQEQEPVLATMLRECSG 47

  Fly    92 LGVPPSGGQQEHFELLQTPQQRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQQ---------QQQ 147
            ..|....|..: |..::..:..:...:|:.|.::..|.|...:|.:::....:         :.|
  Fly    48 CSVHKEDGMPQ-FICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQ 111

  Fly   148 QHESITNAAPTAAPSAQ------RIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSK 206
            ...|:..|..|...|..      ::|..|....|.|:        |.....:.|..|     ...
  Fly   112 MPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISS--------PLPDNNEHKLAQ-----SYS 163

  Fly   207 SAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPY 271
            .|.|.|.||..:.:..|.|.:     .:|.|....|.:|              .:.|.:....|.
  Fly   164 PAKTPHNKSKRRARSYSDNDS-----WSPDSELEHEDDD--------------KIWNASKRGKPK 209

  Fly   272 QCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAF 336
            :         ||.             |:.|:.|.:.|:.|:||::|.||||.||||||.:|.|:|
  Fly   210 R---------VPG-------------PYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSF 252

  Fly   337 EHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLK 401
            ...|.|..|.|.||||||..|..|.|.|.|.|||.:|.||||||:|:||.:  |.:.|.....|:
  Fly   253 AQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSK--CQQSFKQLNGLQ 315

  Fly   402 VHSRTHTGEK 411
            .|...||..|
  Fly   316 KHMSAHTRGK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
COG5048 <270..420 CDD:227381 58/141 (41%)
zf-C2H2 271..293 CDD:278523 2/21 (10%)
C2H2 Zn finger 273..293 CDD:275368 2/19 (11%)
zf-H2C2_2 286..309 CDD:290200 3/22 (14%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 16/24 (67%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 12/21 (57%)
C2H2 Zn finger 357..377 CDD:275368 10/19 (53%)
zf-H2C2_2 370..396 CDD:290200 13/25 (52%)
C2H2 Zn finger 385..407 CDD:275368 5/21 (24%)
zf-H2C2_2 400..424 CDD:290200 4/11 (36%)
C2H2 Zn finger 415..435 CDD:275368
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 20/105 (19%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 8/19 (42%)
zf-H2C2_2 229..254 CDD:290200 16/24 (67%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 13/24 (54%)
C2H2 Zn finger 273..293 CDD:275368 10/19 (53%)
zf-H2C2_2 286..310 CDD:290200 13/25 (52%)
C2H2 Zn finger 301..321 CDD:275368 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.