DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Bcl6b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001101749.1 Gene:Bcl6b / 360551 RGDID:1563179 Length:472 Species:Rattus norvegicus


Alignment Length:403 Identity:108/403 - (26%)
Similarity:160/403 - (39%) Gaps:71/403 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GLGVP----PSGGQQEHF----ELLQTPQQR----------------QMQLQLQDQHQQEQQQFV 131
            |:||.    |.|.:...|    :.:.|.:.|                ||:..:|..|:..|..:.
  Rat    72 GVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYE 136

  Fly   132 SYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFK- 195
            ...::::..:.:..:         .||..|.....::|.....|..:...|| ..||.:.|..| 
  Rat   137 PLGISLRPMEAEPPR---------PPTVPPPGSPRRSEGHPDPPTESRSCSQ-GSPSPASPDPKA 191

  Fly   196 -----------------------------CDQCGMTFGSKSAHTSHTKSHSKNQDLSLNG-ASGA 230
                                         |.|..:..|.::..:|.:.|..:.....|.. .|.|
  Rat   192 CNWKKYKFIVLNSQSSQAGSLAGESSGQPCPQARLPSGDEACSSSSSSSSEEGATPGLQSRLSLA 256

  Fly   231 GVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTG 295
            ...|.....|:..|..   :..|.:......|:...|::...|..|:......:. |........
  Rat   257 TTTARFKCGALANNSY---LFTPPAQETSKQAHPPPGSECLSCQNCEAVAGCSSG-IEPLAPGDE 317

  Fly   296 ERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVC 360
            ::|::|:.|...|..|.||..||.:||.|:||:|.|||..|.....|..|.|||:||:|:||..|
  Rat   318 DKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYRCSVCGARFNRPANLKTHSRIHSGEKPYKCETC 382

  Fly   361 EKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYN 425
            ...|:|...|..|:..|||||||.||.  ||..|...:.||.|.|.||||||||||.|...|.:.
  Rat   383 GSRFVQVAHLRAHVLIHTGEKPYPCPT--CGTRFRHLQTLKSHVRIHTGEKPYHCDPCGLHFRHK 445

  Fly   426 HVLKLHRVQHYGS 438
            ..|:||..|.:|:
  Rat   446 SQLRLHLRQKHGA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 64/149 (43%)
zf-C2H2 271..293 CDD:278523 3/21 (14%)
C2H2 Zn finger 273..293 CDD:275368 3/19 (16%)
zf-H2C2_2 286..309 CDD:290200 4/22 (18%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 14/24 (58%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..396 CDD:290200 14/25 (56%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 16/23 (70%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
Bcl6bNP_001101749.1 BTB 28..132 CDD:279045 12/59 (20%)
BTB 39..131 CDD:197585 12/58 (21%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..360 CDD:290200 14/24 (58%)
C2H2 Zn finger 351..371 CDD:275368 8/19 (42%)
zf-H2C2_2 363..388 CDD:290200 12/24 (50%)
C2H2 Zn finger 379..399 CDD:275368 6/19 (32%)
zf-H2C2_2 391..416 CDD:290200 14/26 (54%)
C2H2 Zn finger 407..427 CDD:275368 9/21 (43%)
zf-H2C2_2 420..444 CDD:290200 16/23 (70%)
C2H2 Zn finger 435..453 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.