DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG17568

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:431 Identity:97/431 - (22%)
Similarity:160/431 - (37%) Gaps:116/431 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VKKSPAKDSATTKMVYYSANQLLIK---TEQSSQAQFCLQVPPPLTATTTSVGLGVPPSGGQQEH 103
            :|..||.:..:.. ||....:||..   .|.|||.   :::....|.|                 
  Fly   120 IKPIPALEMESDN-VYQKPAELLKDFPLAETSSQE---MEISKRTTTT----------------- 163

  Fly   104 FELLQTPQQRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAAP----------- 157
             .|:||.:..:|::        .:|:|:  .|.....:|...|...|.:.:..|           
  Fly   164 -HLIQTKKNVEMEI--------PKQEFI--DLGPILLEKNTSQLDMEDVLDELPQEELSQPRLDS 217

  Fly   158 TAAPSAQR--IKTE------------PVGG-------FPASAAVVSQVRKPSASKPQFKCDQCGM 201
            |.:|::..  :|:|            ||.|       ...:...:....:..|.:.:..|::||.
  Fly   218 TTSPASMENDVKSEMLDSCEGDDDFLPVDGQLMDLVAVATTPNTLESTAEEKAKRGRMDCEKCGK 282

  Fly   202 TFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAA 266
            .:.:::::..|.:...:.                     ||..     |.:.|:.|         
  Fly   283 VYRNRASYEKHLERECRR---------------------IERR-----VKVDKTTT--------- 312

  Fly   267 GADPYQCNVCQKTFAVPARLIRHYR-THTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCD 330
                 .|::|.||.:....|..|.. .|...:|:.|:.|.|.......|..|:.:||:.||::|.
  Fly   313 -----TCDICNKTLSSATALKLHKEGIHQNVKPYICDSCGKQLKTITALNEHKLVHTESRPFECT 372

  Fly   331 VCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFT 395
            ||...|::..:|..|.:|| .|....|::|.|.........:|...||.|:..||..  ||..|.
  Fly   373 VCKAGFKNRARLKAHYQIH-AEPSFVCNICGKKLQTRRTWNMHKVVHTEERRLKCDV--CGALFK 434

  Fly   396 CSKQLKVHSRTHTGEKPYHCDICFRDFGYN-----HVLKLH 431
            .||.||.|..:|||.:||.|:.|.:.|..|     |.||.|
  Fly   435 RSKTLKTHLLSHTGLRPYVCNYCGKSFACNANCRSHKLKKH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 50/150 (33%)
zf-C2H2 271..293 CDD:278523 6/22 (27%)
C2H2 Zn finger 273..293 CDD:275368 6/20 (30%)
zf-H2C2_2 286..309 CDD:290200 7/23 (30%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 313..338 CDD:290200 10/24 (42%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 7/21 (33%)
C2H2 Zn finger 357..377 CDD:275368 4/19 (21%)
zf-H2C2_2 370..396 CDD:290200 9/25 (36%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..435 CDD:275368 8/22 (36%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 52/160 (33%)
C2H2 Zn finger 314..335 CDD:275368 6/20 (30%)
C2H2 Zn finger 343..363 CDD:275368 5/19 (26%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 4/19 (21%)
C2H2 Zn finger 426..446 CDD:275368 9/21 (43%)
zf-H2C2_2 439..463 CDD:290200 11/23 (48%)
C2H2 Zn finger 454..475 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.