DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG15436

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:284 Identity:87/284 - (30%)
Similarity:123/284 - (43%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 SAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAI 241
            ||:......|..:.|..|:|.:|...:..|.....|.::|...|.                    
  Fly   109 SASAADDDGKSDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQS-------------------- 153

  Fly   242 ELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHK 306
                                         :.|..|::.|.:...|..|.:||...:|:||..|.|
  Fly   154 -----------------------------FPCPYCKRNFRLRVTLKAHMKTHNAAKPYECSHCAK 189

  Fly   307 LFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLV 371
            .|:.:..||.|.|.||.|||:||..|.:.|..|..|.||:|.|..|||.|||.|.|||.:...|.
  Fly   190 TFAQQSTLQSHERTHTGERPFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLD 254

  Fly   372 IHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHY 436
            .|.|:||||:|:||..  |.|.|...:.||.|||.|..::|:.|..|.:.|..:..||.|::.|.
  Fly   255 NHFRSHTGERPFKCSH--CPKAFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHN 317

  Fly   437 GSKCYKCTICDETFKNKKEMEAHI 460
            ..:.:||..|...:|.:|.:..||
  Fly   318 AERTFKCPHCASFYKQRKTLARHI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 64/149 (43%)
zf-C2H2 271..293 CDD:278523 5/21 (24%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..309 CDD:290200 9/22 (41%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 13/24 (54%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 14/21 (67%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..396 CDD:290200 13/25 (52%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 7/20 (35%)
C2H2 Zn finger 443..463 CDD:275368 6/18 (33%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368 4/19 (21%)
C2H2 Zn finger 156..176 CDD:275368 5/19 (26%)
COG5048 <180..341 CDD:227381 67/162 (41%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 12/21 (57%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 15/24 (63%)
C2H2 Zn finger 240..260 CDD:275368 9/19 (47%)
zf-H2C2_2 252..276 CDD:290200 12/25 (48%)
C2H2 Zn finger 268..288 CDD:275368 9/21 (43%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
C2H2 Zn finger 324..341 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.