DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and CG8944

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:412 Identity:90/412 - (21%)
Similarity:126/412 - (30%) Gaps:149/412 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PQQRQMQLQLQDQHQQ--EQQQFV---SYQLA--IQQHQKQQQQQQHESITNAAPTAAPSAQRIK 167
            |..|..:.:.:..||.  |.||.:   :.|::  |.|.:....:|:.|              |:.
  Fly   396 PDYRSKERRGEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQKME--------------RLN 446

  Fly   168 TEPVG-GFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAG 231
            :|.:| .|.|:.....|:.......|.|||..|.....:......|..:|..    ||.|.    
  Fly   447 SERLGKKFIANYLYYDQMHFMDDDIPPFKCAHCPEIVQTLRELDLHMLTHQP----SLGGG---- 503

  Fly   232 VAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTG- 295
                                                   |.||:|...|........|.:.|.| 
  Fly   504 ---------------------------------------YYCNICSIQFHNAQEFDNHKQLHLGG 529

  Fly   296 --ERPFECEFCHKLFSVKENLQVHRRIHTKE---------------------------------- 324
              |..|.||.|...|..|.|...|.|.|.:|                                  
  Fly   530 VTEIKFNCELCTASFREKANYDEHLRRHNEELFLPSLALNHSIMEGGLGDDEIGVEGEESRGSGS 594

  Fly   325 -------------------------------------RPYKCDVCGRAFEHSGKLHRHMRIHTGE 352
                                                 :||.||||.|:|...|.|:.|..:|..|
  Fly   595 RRKRRHAAKATDDMVDDDDRIGGGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDE 659

  Fly   353 RP--HKCSV--CEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPY 413
            |.  :||..  |.|:|:....|..|::.|...:.:||..  |||.|..:|.|:.|.:.|...|.|
  Fly   660 RERCYKCDYPQCNKSFVARNSLFEHLKQHYSNEEFKCDI--CGKTFKSTKNLQNHKQIHDKIKRY 722

  Fly   414 HCDICFRDFGYNHVLKLHRVQH 435
            .|.||...|.....|.||:.:|
  Fly   723 VCQICGSAFAQAAGLYLHKRRH 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 3/19 (16%)
COG5048 <270..420 CDD:227381 57/227 (25%)
zf-C2H2 271..293 CDD:278523 6/21 (29%)
C2H2 Zn finger 273..293 CDD:275368 5/19 (26%)
zf-H2C2_2 286..309 CDD:290200 8/25 (32%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 13/95 (14%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 344..366 CDD:290200 9/25 (36%)
C2H2 Zn finger 357..377 CDD:275368 6/21 (29%)
zf-H2C2_2 370..396 CDD:290200 9/25 (36%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 9/23 (39%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510
MADF 379..472 CDD:214738 18/89 (20%)
C2H2 Zn finger 476..496 CDD:275368 3/19 (16%)
C2H2 Zn finger 506..526 CDD:275368 5/19 (26%)
C2H2 Zn finger 537..557 CDD:275368 8/19 (42%)
C2H2 Zn finger 636..656 CDD:275368 9/19 (47%)
zf-C2H2_8 639..712 CDD:292531 25/74 (34%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 9/23 (39%)
C2H2 Zn finger 696..716 CDD:275368 8/21 (38%)
zf-H2C2_2 708..733 CDD:290200 9/24 (38%)
C2H2 Zn finger 724..744 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.