DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and REPIN1

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001374966.1 Gene:REPIN1 / 29803 HGNCID:17922 Length:626 Species:Homo sapiens


Alignment Length:321 Identity:115/321 - (35%)
Similarity:148/321 - (46%) Gaps:24/321 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 TNAAPTAAPS-AQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSH 216
            |...|...|. .:|...:|.        :.|..|..:..|| :.|.:||..|..|....||:|.|
Human   318 TGERPHQCPECGKRFTNKPY--------LTSHRRIHTGEKP-YPCKECGRRFRHKPNLLSHSKIH 373

  Fly   217 SKNQDLSLNGASGAG---------VAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQ 272
            .:::. |...|.|.|         .:|...|.|:.|..|..|.  |.:|...|...:.|....|.
Human   374 KRSEG-SAQAAPGPGSPQLPAGPQESAAEPTPAVPLKPAQEPP--PGAPPEHPQDPIEAPPSLYS 435

  Fly   273 CNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFE 337
            |:.|.::|.:...|..|.|.|||||||.|..|.|.|..|.:|..|.|:|:.|||:.|:.|||.|.
Human   436 CDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFS 500

  Fly   338 HSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKV 402
            ....|..|.|.|..:||..|..|.|.|.....|..|.|.|||||||.||:  |||.|:....|..
Human   501 QGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPD--CGKAFSQKSNLVS 563

  Fly   403 HSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGH 463
            |.|.||||:||.|..|.|.|.....|..||..|.....:.|.||.:||.:::.:.||.|.|
Human   564 HRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKH 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 8/19 (42%)
COG5048 <270..420 CDD:227381 68/149 (46%)
zf-C2H2 271..293 CDD:278523 7/21 (33%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..309 CDD:290200 13/22 (59%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 12/24 (50%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 9/21 (43%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 370..396 CDD:290200 16/25 (64%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 13/23 (57%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523 8/21 (38%)
C2H2 Zn finger 443..463 CDD:275368 8/19 (42%)
REPIN1NP_001374966.1 C2H2 Zn finger 118..138 CDD:275368
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 177..197 CDD:275368
COG5048 <197..371 CDD:227381 16/61 (26%)
C2H2 Zn finger 206..227 CDD:275368
C2H2 Zn finger 238..258 CDD:275368
COG5048 292..599 CDD:227381 106/294 (36%)
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 325..345 CDD:275368 5/27 (19%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)
C2H2 Zn finger 464..484 CDD:275368 8/19 (42%)
C2H2 Zn finger 492..512 CDD:275368 8/19 (42%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 548..568 CDD:275368 9/21 (43%)
C2H2 Zn finger 576..596 CDD:275368 7/19 (37%)
C2H2 Zn finger 604..624 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.