DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zbtb7b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_038957970.1 Gene:Zbtb7b / 295248 RGDID:1305963 Length:597 Species:Rattus norvegicus


Alignment Length:507 Identity:111/507 - (21%)
Similarity:168/507 - (33%) Gaps:187/507 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 QQQQQQHESITNAAPTAA-----------PSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKC 196
            ::.:|..|:...|..||:           |....:...|    |....|..:.|||..:..|.| 
  Rat   211 ERARQYLEAFATATTTASTSGMPNGEDSPPQVPLLPPPP----PPPRPVARRSRKPRKAFLQTK- 270

  Fly   197 DQCGMTFGSKSAH--------TSHTKSHSKNQDLSLNGASG-----------AGVAAP------- 235
                   |:::.|        .:|..::.:.:.:...|.||           ||..:|       
  Rat   271 -------GARANHLVPEAPTVLTHPLAYEEEEMVGRVGNSGGSGLGDNYSPPAGATSPAEGPLNY 328

  Fly   236 -VSTAAIELNDAGLP--VGIPKS--PTIKPLANVAAGADP-------YQCNVCQKTFAVPA---- 284
             |.....|..:...|  .|:.:|  |::.| ..:.:..||       |..::.|...| |.    
  Rat   329 EVFEGEEEEEELVYPPAYGLAQSNEPSLSP-EELGSDEDPIDPDLMAYLSSLHQDALA-PGLDGQ 391

  Fly   285 -RLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRI 348
             :|:|..|:   :.|.||..|||:            ||                .:|||.||||.
  Rat   392 DKLVRKRRS---QMPQECPVCHKI------------IH----------------GAGKLPRHMRT 425

  Fly   349 HTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPY 413
            ||||:|..|.||...|.::.:|.||||.||||:||.||.  |...|..|..||.|...|||::||
  Rat   426 HTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPH--CPARFLHSYDLKNHMHLHTGDRPY 488

  Fly   414 HCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAAS 478
            .|.:|.:                            .|..:..::.|:||.               
  Rat   489 ECHLCHK----------------------------AFAKEDHLQRHLKGQ--------------- 510

  Fly   479 AAASTSAGSSAGSPSLQGVSSNSESSNHSPPSSPPATKKPRQARQPRVSKTVAATLSIPTSSPLS 543
                          :...|.:.....:.:||..||.                :.|.|.|....||
  Rat   511 --------------NCLEVRTRRRRKDDAPPHYPPP----------------STTTSSPAGLDLS 545

  Fly   544 PSSL-------------SSTYSPSASSMASPPPTSAHYLPVQMEADALSRDS 582
            ...|             |:|..|..::...|........|...:|::....|
  Rat   546 NGHLDTFRLSLARFWEQSATTGPPVTTQGPPEEEEEEGTPTTPQAESAMESS 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 3/27 (11%)
COG5048 <270..420 CDD:227381 58/161 (36%)
zf-C2H2 271..293 CDD:278523 7/26 (27%)
C2H2 Zn finger 273..293 CDD:275368 6/24 (25%)
zf-H2C2_2 286..309 CDD:290200 9/22 (41%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
zf-H2C2_2 313..338 CDD:290200 2/24 (8%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 344..366 CDD:290200 13/21 (62%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 2/19 (11%)
zf-C2H2 441..463 CDD:278523 3/21 (14%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
Zbtb7bXP_038957970.1 BTB_POZ_ZBTB7B_ZBTB15 63..196 CDD:349636
COG5048 403..>482 CDD:227381 43/108 (40%)
C2H2 Zn finger 406..426 CDD:275368 13/47 (28%)
zf-H2C2_2 421..443 CDD:404364 13/21 (62%)
C2H2 Zn finger 434..454 CDD:275368 9/19 (47%)
C2H2 Zn finger 462..482 CDD:275368 8/21 (38%)
zf-H2C2_2 474..499 CDD:404364 11/52 (21%)
C2H2 Zn finger 490..508 CDD:275368 4/45 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.