DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and BCL6B

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_862827.2 Gene:BCL6B / 255877 HGNCID:1002 Length:479 Species:Homo sapiens


Alignment Length:420 Identity:118/420 - (28%)
Similarity:171/420 - (40%) Gaps:98/420 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GLGVP----PSGGQQEHF----ELLQTPQQR----------------QMQLQLQDQHQQEQQQFV 131
            |:||.    |.|.:...|    :.:.|.:.|                ||:..:|..|:..|..:.
Human    72 GVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYE 136

  Fly   132 SYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFK- 195
            ...::::..:.:..         ..|||.|.....::|.....|..:...|| ..||.:.|..| 
Human   137 PLGISLRPLEAEPP---------TPPTAPPPGSPRRSEGHPDPPTESRSCSQ-GPPSPASPDPKA 191

  Fly   196 CD--------------QCGMTFGSKS---------------AHTSHTKSHSKNQDLSLNG----- 226
            |:              |.|...|.:|               |.:|.:.|.|.:::..:.|     
Human   192 CNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSSSSSSEEGPIPGPQSRL 256

  Fly   227 -ASGAGV----AAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFA----- 281
             .:.|.|    .||.||..:..:.|....|.| |...:||    .|::.:.|..|:....     
Human   257 SPTAATVQFKCGAPASTPYLLTSQAQDTSGSP-SERARPL----PGSEFFSCQNCEAVAGCSSGL 316

  Fly   282 ---VPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLH 343
               ||.         ..::|::|:.|...|..|.||..||.:||.|:||.|.:||..|.....|.
Human   317 DSLVPG---------DEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARFNRPANLK 372

  Fly   344 RHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHT 408
            .|.|||:||:|:||..|...|:|...|..|:..|||||||.||.  ||..|...:.||.|.|.||
Human   373 THSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPT--CGTRFRHLQTLKSHVRIHT 435

  Fly   409 GEKPYHCDICFRDFGYNHVLKLHRVQHYGS 438
            ||||||||.|...|.:...|:||..|.:|:
Human   436 GEKPYHCDPCGLHFRHKSQLRLHLRQKHGA 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 7/48 (15%)
COG5048 <270..420 CDD:227381 64/157 (41%)
zf-C2H2 271..293 CDD:278523 4/29 (14%)
C2H2 Zn finger 273..293 CDD:275368 4/27 (15%)
zf-H2C2_2 286..309 CDD:290200 3/22 (14%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 13/24 (54%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..396 CDD:290200 14/25 (56%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 16/23 (70%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
BCL6BNP_862827.2 BTB_POZ 19..132 CDD:365784 12/59 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..190 11/56 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..259 8/48 (17%)
C2H2 Zn finger 330..350 CDD:275368 8/19 (42%)
COG5048 354..>411 CDD:227381 25/56 (45%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..395 CDD:372612 12/24 (50%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2 412..434 CDD:333835 10/23 (43%)
C2H2 Zn finger 414..434 CDD:275368 9/21 (43%)
zf-H2C2_2 427..451 CDD:372612 16/23 (70%)
C2H2 Zn finger 442..460 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.