DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zfp362

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001074567.1 Gene:Zfp362 / 230761 MGIID:2652839 Length:418 Species:Mus musculus


Alignment Length:403 Identity:106/403 - (26%)
Similarity:176/403 - (43%) Gaps:56/403 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PPPLTATTTSVGLGVPPSGGQQEHFELLQTPQQRQMQLQLQDQH-----QQEQQQFVSYQLAIQQ 139
            |||            |....|.::..|:...:::.|..:::..|     ...||..:......:.
Mouse    26 PPP------------PTMPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAES 78

  Fly   140 HQKQQQQQQHESITNAAPTAAPSAQ-----RIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQC 199
            .|......:.:.:....|.:.|...     |..|..|.|...|:      |.|:.|..:   ...
Mouse    79 SQAVMSLPKLQQVPGLHPQSVPQPDVALHARPATSTVTGLGLSS------RTPAVSTSE---STP 134

  Fly   200 GMTFGSKSAHTSHTKSHSKNQDLSLNGASG---AGVAAPVSTAAIE-LNDAGLPVGIPKSPT-IK 259
            |...|:.:..|..|.|.|:     |..:|.   :|:.:|....:|: :...|| :|.|||.. .|
Mouse   135 GTGTGTSTPSTPTTTSQSR-----LIASSPTLISGITSPPLLDSIKTIQGHGL-LGPPKSERGRK 193

  Fly   260 PLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKE 324
            .:.....|..|        ...||..::....|....:.:.|:.|...|..|..:|:|.:.||:.
Mouse   194 KIKAENPGGPP--------VLVVPYPILASGETAKEGKTYRCKVCPLTFFTKSEMQIHSKSHTEA 250

  Fly   325 RPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPG 389
            :|:||..|.::|.::..|.:|:|||.|.:|:.||.|:|:|.|...|..|.|.|||::|||||.||
Mouse   251 KPHKCPHCSKSFANASYLAQHLRIHLGVKPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPG 315

  Fly   390 CGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKL----HRVQHYGSKCYKCTICDETF 450
            |.|.||....|:.|.|.|..:|||.|..|:|.:..:..|::    |.::|  :|.|.|::|...:
Mouse   316 CEKAFTQLSNLQSHQRQHNKDKPYKCPNCYRAYSDSASLQIHLSAHAIKH--AKAYCCSMCGRAY 378

  Fly   451 KNKKEMEAHIKGH 463
            .::..:..|:..|
Mouse   379 TSETYLMKHMSKH 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 56/149 (38%)
zf-C2H2 271..293 CDD:278523 2/21 (10%)
C2H2 Zn finger 273..293 CDD:275368 2/19 (11%)
zf-H2C2_2 286..309 CDD:290200 3/22 (14%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 313..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..396 CDD:290200 16/25 (64%)
C2H2 Zn finger 385..407 CDD:275368 11/21 (52%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 5/23 (22%)
zf-C2H2 441..463 CDD:278523 4/21 (19%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
Zfp362NP_001074567.1 PRK14971 <27..>131 CDD:237874 20/121 (17%)
C2H2 Zn finger 227..247 CDD:275368 6/19 (32%)
zf-H2C2_2 239..264 CDD:404364 9/24 (38%)
zf-C2H2 253..275 CDD:395048 7/21 (33%)
C2H2 Zn finger 255..275 CDD:275368 6/19 (32%)
zf-H2C2_2 267..292 CDD:404364 12/24 (50%)
C2H2 Zn finger 283..303 CDD:275368 9/19 (47%)
SFP1 <305..357 CDD:227516 23/51 (45%)
C2H2 Zn finger 311..333 CDD:275368 11/21 (52%)
C2H2 Zn finger 341..361 CDD:275368 4/19 (21%)
C2H2 Zn finger 373..391 CDD:275368 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.