DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zbtb7b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001342135.1 Gene:Zbtb7b / 22724 MGIID:102755 Length:607 Species:Mus musculus


Alignment Length:458 Identity:113/458 - (24%)
Similarity:165/458 - (36%) Gaps:131/458 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 QQQQQQHESITNAAPTAA-----------PSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKC 196
            ::.:|..|:...|..||:           |....:...|    |....|..:.|||..:..|.| 
Mouse   220 ERARQYLEAFATATTTASTSGMPNGEDSPPQVPLLPPPP----PPPRPVARRSRKPRKAFLQTK- 279

  Fly   197 DQCGMTFGSKSAH--------TSHTKSHSKNQDLSLNGASG-----------AGVAAP------- 235
                   |:::.|        .:|..::.:.:.:...|.||           .|.|:|       
Mouse   280 -------GARANHLVPEAPTVLTHPLTYEEEEMVGRLGNSGGSGLGDSYSPPTGAASPAEGPLNY 337

  Fly   236 -VSTAAIELNDAGLPVGI----PKSPTIKPLANVAAGADP-------YQCNVCQKTFAVPA---- 284
             |.....|..:...|.|.    ...|::.| ..:.:..||       |..::.|... .|.    
Mouse   338 EVFEGEEEEEEMAYPPGYGLAQSNEPSLSP-EELGSDEDPIDPDLMAYLSSLHQDAL-TPGLDGQ 400

  Fly   285 -RLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRI 348
             :|:|..|:   :.|.||..|||:            ||                .:|||.||||.
Mouse   401 DKLVRKRRS---QMPQECPVCHKI------------IH----------------GAGKLPRHMRT 434

  Fly   349 HTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPY 413
            ||||:|..|.||...|.::.:|.||||.||||:||.||.  |...|..|..||.|...|||::||
Mouse   435 HTGEKPFACEVCGVRFTRNDKLKIHMRKHTGERPYSCPH--CPARFLHSYDLKNHMHLHTGDRPY 497

  Fly   414 HCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAAS 478
            .|.:|.:.|.....|:.|.   .|..|.:.    .|.:.:|              ||  .||...
Mouse   498 ECHLCHKAFAKEDHLQRHL---KGQNCLEV----RTRRRRK--------------DD--VAAPHY 539

  Fly   479 AAASTSAGSSAGSPSLQGVSSNSESS-----NHSPPSSPPATKK--PRQARQPRVSKTVAATLSI 536
            ...||:..|.||.....|.......|     ..|..:.||.|.:  |.:..:.....|..|..::
Mouse   540 PPPSTTTSSPAGLDLSNGHLDTFHLSLARFWEQSATTGPPVTTQGPPEEEEEEGTPTTPQAEGAM 604

  Fly   537 PTS 539
            .:|
Mouse   605 ESS 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 3/27 (11%)
COG5048 <270..420 CDD:227381 57/161 (35%)
zf-C2H2 271..293 CDD:278523 6/26 (23%)
C2H2 Zn finger 273..293 CDD:275368 5/24 (21%)
zf-H2C2_2 286..309 CDD:290200 9/22 (41%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
zf-H2C2_2 313..338 CDD:290200 2/24 (8%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 344..366 CDD:290200 13/21 (62%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-C2H2 441..463 CDD:278523 2/21 (10%)
C2H2 Zn finger 443..463 CDD:275368 2/19 (11%)
Zbtb7bNP_001342135.1 BTB 87..207 CDD:306997
COG5048 412..>491 CDD:227381 43/108 (40%)
C2H2 Zn finger 415..435 CDD:275368 13/47 (28%)
zf-H2C2_2 430..452 CDD:316026 13/21 (62%)
C2H2 Zn finger 443..463 CDD:275368 9/19 (47%)
C2H2 Zn finger 471..491 CDD:275368 8/21 (38%)
zf-H2C2_2 483..508 CDD:316026 11/24 (46%)
C2H2 Zn finger 499..517 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.