DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Zbtb7c

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:XP_036016934.1 Gene:Zbtb7c / 207259 MGIID:2443302 Length:625 Species:Mus musculus


Alignment Length:152 Identity:57/152 - (37%)
Similarity:77/152 - (50%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 AAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEF 303
            :|..|.....|..:.:...:||.|:       .||.:|.|......:|.||.||||||:|:.|..
Mouse   345 SATHLGSLFPPWPLVEERKLKPKAS-------QQCPICHKVIMGAGKLPRHMRTHTGEKPYMCSI 402

  Fly   304 CHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSG 368
            |...|:.::.|::|.|.||.||||.|..|...|.|:..|..|||||||.||::|..|.|:|.:|.
Mouse   403 CEVRFTRQDKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSD 467

  Fly   369 QLVIHM--------RTHTGEKP 382
            .|..|:        |...|.||
Mouse   468 HLHRHIKRQSCRMARPRRGRKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368
COG5048 <270..420 CDD:227381 51/121 (42%)
zf-C2H2 271..293 CDD:278523 8/21 (38%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..309 CDD:290200 12/22 (55%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 313..338 CDD:290200 12/24 (50%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 13/21 (62%)
C2H2 Zn finger 357..377 CDD:275368 8/27 (30%)
zf-H2C2_2 370..396 CDD:290200 6/21 (29%)
C2H2 Zn finger 385..407 CDD:275368
zf-H2C2_2 400..424 CDD:290200
C2H2 Zn finger 415..435 CDD:275368
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
Zbtb7cXP_036016934.1 BTB_POZ_ZBTB7C_ZBTB36 15..134 CDD:349637
C2H2 Zn finger 372..392 CDD:275368 7/19 (37%)
SFP1 <386..474 CDD:227516 42/87 (48%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..448 CDD:275368 8/19 (42%)
C2H2 Zn finger 456..474 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.