| Sequence 1: | NP_477466.1 | Gene: | Kr-h1 / 33861 | FlyBaseID: | FBgn0266450 | Length: | 845 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016881094.1 | Gene: | ZBTB7C / 201501 | HGNCID: | 31700 | Length: | 668 | Species: | Homo sapiens |
| Alignment Length: | 277 | Identity: | 80/277 - (28%) |
|---|---|---|---|
| Similarity: | 113/277 - (40%) | Gaps: | 44/277 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 258 IKPLANVAAGADPYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHT 322
Fly 323 KERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHM--------RTHTG 379
Fly 380 EKP--YKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYH---CDICFRDFGYNHVLKLHRVQHYGSK 439
Fly 440 CYKCTICDETFKNKKEMEAHIKGHANEVPDDEAEAAAASAAASTSAGSS-------------AGS 491
Fly 492 PSLQG---VSSNSESSN 505 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kr-h1 | NP_477466.1 | C2H2 Zn finger | 196..216 | CDD:275368 | |
| COG5048 | <270..420 | CDD:227381 | 57/162 (35%) | ||
| zf-C2H2 | 271..293 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 286..309 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 313..338 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 329..349 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 344..366 | CDD:290200 | 13/21 (62%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 8/27 (30%) | ||
| zf-H2C2_2 | 370..396 | CDD:290200 | 8/35 (23%) | ||
| C2H2 Zn finger | 385..407 | CDD:275368 | 2/21 (10%) | ||
| zf-H2C2_2 | 400..424 | CDD:290200 | 4/26 (15%) | ||
| C2H2 Zn finger | 415..435 | CDD:275368 | 1/19 (5%) | ||
| zf-C2H2 | 441..463 | CDD:278523 | 2/21 (10%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 2/19 (11%) | ||
| ZBTB7C | XP_016881094.1 | BTB | 73..176 | CDD:279045 | |
| BTB | 84..177 | CDD:197585 | |||
| C2H2 Zn finger | 415..435 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 430..452 | CDD:290200 | 12/21 (57%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 456..480 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 483..508 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 499..517 | CDD:275368 | 7/17 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||