DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and M03D4.4

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:437 Identity:104/437 - (23%)
Similarity:158/437 - (36%) Gaps:143/437 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 RTHTGER-PFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERP 354
            ::.:||: .:|||.||::|:||..|..|.|||:.|:|:.|..||:.|.....|.:|...|||||.
 Worm    79 KSSSGEKGRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLLKKHWMWHTGERS 143

  Fly   355 HKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICF 419
            |.|..|.|.|.|.|.|..|:..|:|.:|::||:  |.|.|.....|..|.:.|. |:.:.|..|.
 Worm   144 HVCPHCNKAFFQKGHLTQHLMIHSGGRPHECPQ--CHKTFIFKFDLNRHMKIHQ-ERGFSCQQCG 205

  Fly   420 RDFGYNHVLKLHRV--------------------------------------------------- 433
            |.|....:|..|.:                                                   
 Worm   206 RSFLKQVMLDEHHLKCKGKPSSPIRSLLTPTMKAGLESAISIKPPQESMILSSETIAKMAQKLLI 270

  Fly   434 ----------------QH---------------YGSKCYK----------------CTICDETFK 451
                            ||               .||..:|                |.||...|.
 Worm   271 QQQENHRNALNTLLVKQHENILNNNNNNESNILNGSVMHKDAGFEIPAPTIPLSLTCMICKSQFN 335

  Fly   452 NKKEMEAHIKGH--ANEVPDDEAEAAAASAAASTSAGSSAGSPSLQGVSSNSESSNHSPPSSPPA 514
            ::.....|:..|  ||:.|:...::.........:..|....|:..| |.:..:::.|..|||..
 Worm   336 SQPSFTLHMYMHHIANQNPNLSIDSTHIHHTHQPTTISHQNDPTPLG-SDSDLATDTSCASSPQK 399

  Fly   515 TKKPRQARQPRVSKTVAATLSIPTSSPLSPSSLSSTYSPSASSMASPPPTSAHYLPVQMEADALS 579
            |                :.|.:..||.|..||:    |||:||.|||.||::             
 Worm   400 T----------------SPLQLLESSCLEQSSV----SPSSSSGASPQPTAS------------- 431

  Fly   580 RDSGVSSAQPAHSTYADEEPTDLSMQQVQGQLPESTVDYYQAPPSLL 626
             :|..||.:...:::  :...||..|.|:..  |...:|.|....::
 Worm   432 -ESSTSSCKDCTNSW--QRVHDLEQQMVKKD--EEFENYKQMTKQII 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368
COG5048 <270..420 CDD:227381 51/129 (40%)
zf-C2H2 271..293 CDD:278523 0/1 (0%)
C2H2 Zn finger 273..293 CDD:275368 0/1 (0%)
zf-H2C2_2 286..309 CDD:290200 7/18 (39%)
C2H2 Zn finger 301..321 CDD:275368 10/19 (53%)
zf-H2C2_2 313..338 CDD:290200 11/24 (46%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 370..396 CDD:290200 10/25 (40%)
C2H2 Zn finger 385..407 CDD:275368 7/21 (33%)
zf-H2C2_2 400..424 CDD:290200 8/23 (35%)
C2H2 Zn finger 415..435 CDD:275368 6/86 (7%)
zf-C2H2 441..463 CDD:278523 6/37 (16%)
C2H2 Zn finger 443..463 CDD:275368 5/19 (26%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 10/19 (53%)
zf-H2C2_2 102..127 CDD:290200 11/24 (46%)
C2H2 Zn finger 118..138 CDD:275368 6/19 (32%)
C2H2 Zn finger 146..166 CDD:275368 8/19 (42%)
zf-H2C2_2 158..181 CDD:290200 9/24 (38%)
zf-C2H2 172..194 CDD:278523 7/23 (30%)
C2H2 Zn finger 174..194 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.