| Sequence 1: | NP_477466.1 | Gene: | Kr-h1 / 33861 | FlyBaseID: | FBgn0266450 | Length: | 845 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006513342.3 | Gene: | Zbtb7a / 16969 | MGIID: | 1335091 | Length: | 725 | Species: | Mus musculus |
| Alignment Length: | 327 | Identity: | 90/327 - (27%) |
|---|---|---|---|
| Similarity: | 134/327 - (40%) | Gaps: | 79/327 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 226 GASGAGV----AAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARL 286
Fly 287 IRHYRTHTGERPFECE-----------FCHKLFSVKENLQVH--------RRIHTKERPYKCDVC 332
Fly 333 GRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCS 397
Fly 398 KQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKG 462
Fly 463 HANEVP-------------------------DDEAEAAAASAAASTSAGS----SAGSPSLQGVS 498
Fly 499 SN 500 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kr-h1 | NP_477466.1 | C2H2 Zn finger | 196..216 | CDD:275368 | |
| COG5048 | <270..420 | CDD:227381 | 54/168 (32%) | ||
| zf-C2H2 | 271..293 | CDD:278523 | 2/21 (10%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 286..309 | CDD:290200 | 4/33 (12%) | ||
| C2H2 Zn finger | 301..321 | CDD:275368 | 5/38 (13%) | ||
| zf-H2C2_2 | 313..338 | CDD:290200 | 6/32 (19%) | ||
| C2H2 Zn finger | 329..349 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 344..366 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 370..396 | CDD:290200 | 15/25 (60%) | ||
| C2H2 Zn finger | 385..407 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 400..424 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 415..435 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 441..463 | CDD:278523 | 2/21 (10%) | ||
| C2H2 Zn finger | 443..463 | CDD:275368 | 1/19 (5%) | ||
| Zbtb7a | XP_006513342.3 | BTB_POZ_ZBTB7A | 165..284 | CDD:349635 | |
| C2H2 Zn finger | 534..554 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 549..571 | CDD:404364 | 11/21 (52%) | ||
| C2H2 Zn finger | 562..582 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 575..599 | CDD:404364 | 15/25 (60%) | ||
| C2H2 Zn finger | 590..610 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 602..627 | CDD:404364 | 13/24 (54%) | ||
| C2H2 Zn finger | 618..636 | CDD:275368 | 6/26 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||