DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and ZBTB49

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001317554.1 Gene:ZBTB49 / 166793 HGNCID:19883 Length:765 Species:Homo sapiens


Alignment Length:494 Identity:143/494 - (28%)
Similarity:209/494 - (42%) Gaps:55/494 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSHTK 214
            :.:.::||  .|.:.....:||.......|:  .::|.:..|.|...:|.... .|....|...:
Human   279 QPVNDSAP--HPESDATCQQPVKQMRLKKAI--HLKKLNFLKSQKYAEQVSEP-KSDDGLTKRLE 338

  Fly   215 SHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGL--PVGIPKSP-TIKPLANVAAGADPYQCNVC 276
            |.|||   :|..||........|...:...:...  ....|:.| .::..:........|.|.:|
Human   339 SASKN---TLEKASSQSAEEKESEEVVSCENFNCISETERPEDPAALEDQSQTLQSQRQYACELC 400

  Fly   277 QKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGK 341
            .|.|..|:.|..|.|:||||:||||..|.|.||...|||.|.|.|:.|:||.|::||:.|..||.
Human   401 GKPFKHPSNLELHKRSHTGEKPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGD 465

  Fly   342 LHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRT 406
            :.||:.||:||:||.|.:|.:.|.....|..|.:|||.:|.:.|.|  |||.|...::|..|...
Human   466 VQRHIIIHSGEKPHLCDICGRGFSNFSNLKEHKKTHTADKVFTCDE--CGKSFNMQRKLVKHRIR 528

  Fly   407 HTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKNKKEMEAHIKGH---ANEVP 468
            ||||:||.|..|.:.||.:..|:.|...|.|.|.|.|.||::.|.....:..|.|.|   .:|.|
Human   529 HTGERPYSCSACGKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCKAGDESP 593

  Fly   469 D------DEAEAAAASAAASTSAGSSAGSPSLQGVS----------SNSESSNHSPPSSPPATKK 517
            |      ...|.:....:.|:.:.|...|.:|..||          |.:|..:||..|    ..|
Human   594 DVLEELSQAIETSDLEKSQSSDSFSQDTSVTLMPVSVKLPVHPVENSVAEFDSHSGGS----YCK 654

  Fly   518 PRQARQPRVSKTVAATLSIPTSSPLSPSSLSSTYSPSASSMA---SPPPTSAHYLPVQMEADALS 579
            .|...||.       .:|......|.|..|:..........|   |...|.|...|:|.:..|:.
Human   655 LRSMIQPH-------GVSDQEKLSLDPGKLAKPQMQQTQPQAYAYSDVDTPAGGEPLQADGMAMI 712

  Fly   580 RDSGVS---------SAQPAHSTYADEEPTDLSMQQVQG 609
            |.|..:         .::.:.:||.:.|....|...:.|
Human   713 RSSLAALDNHGGDPLGSRASSTTYRNSEGQFFSSMTLWG 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 3/19 (16%)
COG5048 <270..420 CDD:227381 69/149 (46%)
zf-C2H2 271..293 CDD:278523 9/21 (43%)
C2H2 Zn finger 273..293 CDD:275368 8/19 (42%)
zf-H2C2_2 286..309 CDD:290200 13/22 (59%)
C2H2 Zn finger 301..321 CDD:275368 10/19 (53%)
zf-H2C2_2 313..338 CDD:290200 13/24 (54%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
zf-H2C2_2 370..396 CDD:290200 12/25 (48%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 11/23 (48%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 7/21 (33%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
ZBTB49NP_001317554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..294 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.