DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Gfi1b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001153878.1 Gene:Gfi1b / 14582 MGIID:1276578 Length:363 Species:Mus musculus


Alignment Length:360 Identity:106/360 - (29%)
Similarity:148/360 - (41%) Gaps:75/360 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QHQQEQQQFVSYQLAIQQHQKQQQQQQHESITNAA---PTAAPSAQRIKTEPVGG-FPASAAVVS 182
            :|.|.....:|..|..|.......:|:.|.:.|.:   ..:||....:..:|..| .|.|     
Mouse    37 EHSQSASPLLSTPLPSQTLDWNTIKQEREMLLNQSLPKMASAPEGPLVTPQPQDGESPLS----- 96

  Fly   183 QVRKPSASKPQFKCDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAG 247
              ..|...||.|..|    |..|..:| |:|::.|..|...|.             .::.|    
Mouse    97 --ESPPFYKPSFSWD----TLASSYSH-SYTQTPSTMQSAFLE-------------RSVRL---- 137

  Fly   248 LPVGIPKSP-TIKPL---ANVAAGADPYQCNVCQKTFAVPARLIRHY-RTHTGERPFECEFCHKL 307
              .|.|..| |..||   ...:.|.|.|.|..|.|.|:.|..|..|. |:|:|.|||.|:.|.|.
Mouse   138 --YGSPLVPSTESPLDFRLRYSPGMDTYHCVKCNKVFSTPHGLEVHVRRSHSGTRPFACDVCGKT 200

  Fly   308 FSVKENLQVHRRIHT---------------------------------KERPYKCDVCGRAFEHS 339
            |....:|:.|..:|:                                 :||.::|.:||:||:.|
Mouse   201 FGHAVSLEQHTHVHSQGVPAGSSPTPTLAVPGLEAPPAPDPPGPRFLRQERSFECRMCGKAFKRS 265

  Fly   340 GKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHS 404
            ..|..|:.||:..||:.|..|.|.|.|...:..|...||||||:||..  |||.|:.|..|..||
Mouse   266 STLSTHLLIHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQV--CGKAFSQSSNLITHS 328

  Fly   405 RTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSK 439
            |.|||.||:.|::|.:.|.....|:.||...:..|
Mouse   329 RKHTGFKPFSCELCTKGFQRKVDLRRHRESQHNLK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/19 (32%)
COG5048 <270..420 CDD:227381 65/183 (36%)
zf-C2H2 271..293 CDD:278523 9/22 (41%)
C2H2 Zn finger 273..293 CDD:275368 8/20 (40%)
zf-H2C2_2 286..309 CDD:290200 11/23 (48%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)
zf-H2C2_2 313..338 CDD:290200 10/57 (18%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 344..366 CDD:290200 9/21 (43%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..396 CDD:290200 13/25 (52%)
C2H2 Zn finger 385..407 CDD:275368 10/21 (48%)
zf-H2C2_2 400..424 CDD:290200 12/23 (52%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
Gfi1bNP_001153878.1 C2H2 Zn finger 165..186 CDD:275368 8/20 (40%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
zf-C2H2 253..275 CDD:278523 8/21 (38%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
COG5048 263..>340 CDD:227381 35/78 (45%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 295..320 CDD:290200 13/26 (50%)
C2H2 Zn finger 311..331 CDD:275368 10/21 (48%)
C2H2 Zn finger 339..356 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.