DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and Bcl6b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_031554.1 Gene:Bcl6b / 12029 MGIID:1278332 Length:474 Species:Mus musculus


Alignment Length:411 Identity:110/411 - (26%)
Similarity:161/411 - (39%) Gaps:85/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GLGVP----PSGGQQEHF----ELLQTPQQR----------------QMQLQLQDQHQQEQQQFV 131
            ||||.    |.|.:...|    :.:.|.:.|                ||:..:|..|:..|..:.
Mouse    72 GLGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQMEHVVQACHRFIQASYE 136

  Fly   132 SYQLAIQQHQKQQQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFK- 195
            ...::::..:.:..:         .||.||.....::|.....|..:...|| ..||.:.|..| 
Mouse   137 PLGISLRPVEVEPPR---------PPTVAPPGSPRRSEGHPDPPTESRSCSQ-GSPSPASPDPKA 191

  Fly   196 -----------------------------CDQCGMTFGSKSAHTSHTKSHSKNQDLSLNGASGAG 231
                                         |.|..:..|.::..:|.:........|. :..|.|.
Mouse   192 CNWKKYKFIVLNSQTSQAGSLVGESSGQPCPQARLPSGDEACSSSSSSEEGTTPGLQ-SRLSLAT 255

  Fly   232 VAAPVSTAAIELN---------DAGLPVGIPKSPTIKPLANVAAGADPYQCNVCQKTFAVPARLI 287
            ..|.....|:..|         :..||.        ...||...|::.:.|..|:......:.| 
Mouse   256 TTARFKCGALANNSYLFTPRAQETSLPA--------SKQANPPPGSEFFSCQNCEAVAGCSSGL- 311

  Fly   288 RHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGE 352
            ........::|::|:.|...|..|.||..||.:||.|:||:|.:||..|.....|..|.|||:||
Mouse   312 ELLAPGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPYRCSICGARFNRPANLKTHSRIHSGE 376

  Fly   353 RPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDI 417
            :|:||..|...|:|...|..|:..|||||||.||.  ||..|...:.||.|.|.||||||||||.
Mouse   377 KPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPT--CGTRFRHLQTLKSHVRIHTGEKPYHCDP 439

  Fly   418 CFRDFGYNHVLKLHRVQHYGS 438
            |...|.:...|:||..|.:|:
Mouse   440 CGLHFRHKSQLRLHLRQKHGA 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 63/149 (42%)
zf-C2H2 271..293 CDD:278523 3/21 (14%)
C2H2 Zn finger 273..293 CDD:275368 3/19 (16%)
zf-H2C2_2 286..309 CDD:290200 4/22 (18%)
C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
zf-H2C2_2 313..338 CDD:290200 13/24 (54%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 6/19 (32%)
zf-H2C2_2 370..396 CDD:290200 14/25 (56%)
C2H2 Zn finger 385..407 CDD:275368 9/21 (43%)
zf-H2C2_2 400..424 CDD:290200 16/23 (70%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
zf-C2H2 441..463 CDD:278523
C2H2 Zn finger 443..463 CDD:275368
Bcl6bNP_031554.1 BTB 28..132 CDD:279045 13/59 (22%)
BTB 39..131 CDD:197585 13/58 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..190 11/55 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..249 5/39 (13%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
zf-H2C2_2 337..362 CDD:290200 13/24 (54%)
C2H2 Zn finger 353..373 CDD:275368 7/19 (37%)
zf-H2C2_2 365..390 CDD:290200 12/24 (50%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
zf-H2C2_2 393..418 CDD:290200 14/26 (54%)
C2H2 Zn finger 409..429 CDD:275368 9/21 (43%)
zf-H2C2_2 422..446 CDD:290200 16/23 (70%)
C2H2 Zn finger 437..455 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.