DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h1 and znf362b

DIOPT Version :9

Sequence 1:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster
Sequence 2:NP_001083017.1 Gene:znf362b / 100038768 ZFINID:ZDB-GENE-070424-35 Length:438 Species:Danio rerio


Alignment Length:458 Identity:119/458 - (25%)
Similarity:185/458 - (40%) Gaps:94/458 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLDISKSPAKAVAVKKSPAKDSATTKMVYYSANQLLIKTEQSSQAQFCLQVP-----PPLTATTT 88
            |:.|.|...:.:|.|..|.....||   ..|...||:.::.|...|..:.:|     |.|.|..:
Zfish    25 LVLIDKIKEQLMAEKIRPPHLPPTT---VPSQQTLLVASQPSDAGQHVMSIPKLQQVPGLQAHNS 86

  Fly    89 S---VGLGVPPSGGQQEHFELLQTPQQRQMQLQLQDQHQQ---EQQQFVSYQLAIQQHQKQQQQQ 147
            |   :.|...|:........:......:...| .:|.|.:   ||....:::..:....:.....
Zfish    87 SQPDIALHARPASSTIAELSIDDKSTVKAKGL-WEDWHMRQAVEQASRTNHRSGLTLSSRTDSHN 150

  Fly   148 QHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQFKCDQCGMTFGSKSAHTSH 212
            ..|:||...||:: |..|:      |..||...:|.:    ||.|       ||         .|
Zfish   151 TSEAITPTTPTSS-SQNRL------GGAASLNTISGL----ASGP-------GM---------EH 188

  Fly   213 TKSHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPTIKPLANVAAGAD-------- 269
            .||.      .|.|..|....||.....|:......|:      .:.|...:|:|.|        
Zfish   189 IKSG------GLVGMLGPQPKAPRGRKKIKAEHNTGPL------LVVPYPLLASGPDQAVTIAKE 241

  Fly   270 --PYQCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVC 332
              .|:|.||.:|                        |..    |..:|:|.:.||:.:|:||..|
Zfish   242 GKTYRCKVCPRT------------------------CFN----KSEMQIHSKSHTEAKPHKCPHC 278

  Fly   333 GRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCS 397
            .::|.::..|.:|:|||.|.:|:.||.||.:|.|...|..|.|.|||::||||.:|||.|.||..
Zfish   279 SKSFANASYLAQHLRIHLGIKPYHCSYCENSFRQLSHLQQHTRIHTGDRPYKCAQPGCEKAFTQL 343

  Fly   398 KQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQH--YGSKCYKCTICDETFKNKKEMEAHI 460
            ..|:.|.|.|..:|||.|..|:|.:..:..|::|...|  ..:|.|.|::|...:.::..:..|:
Zfish   344 SNLQSHQRQHNKDKPYKCPNCYRAYTDSASLQIHLSAHAIKNAKSYCCSMCGRAYTSETYLMKHM 408

  Fly   461 KGH 463
            ..|
Zfish   409 SKH 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 4/19 (21%)
COG5048 <270..420 CDD:227381 54/149 (36%)
zf-C2H2 271..293 CDD:278523 5/21 (24%)
C2H2 Zn finger 273..293 CDD:275368 4/19 (21%)
zf-H2C2_2 286..309 CDD:290200 1/22 (5%)
C2H2 Zn finger 301..321 CDD:275368 4/19 (21%)
zf-H2C2_2 313..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 11/21 (52%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 10/21 (48%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
zf-C2H2 441..463 CDD:278523 4/21 (19%)
C2H2 Zn finger 443..463 CDD:275368 3/19 (16%)
znf362bNP_001083017.1 C2H2 Zn finger 247..267 CDD:275368 8/47 (17%)
zf-H2C2_2 259..284 CDD:290200 9/24 (38%)
C2H2 Zn finger 275..295 CDD:275368 6/19 (32%)
zf-H2C2_2 287..312 CDD:290200 12/24 (50%)
C2H2 Zn finger 303..323 CDD:275368 9/19 (47%)
zf-H2C2_2 315..342 CDD:290200 15/26 (58%)
C2H2 Zn finger 331..353 CDD:275368 10/21 (48%)
zf-H2C2_2 345..369 CDD:290200 10/23 (43%)
C2H2 Zn finger 361..381 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..411 CDD:275368 1/15 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.