DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP29 and CG15528

DIOPT Version :10

Sequence 1:NP_001003892.1 Gene:DUSP29 / 338599 HGNCID:23481 Length:220 Species:Homo sapiens
Sequence 2:NP_651767.2 Gene:CG15528 / 43575 FlyBaseID:FBgn0039742 Length:227 Species:Drosophila melanogaster


Alignment Length:154 Identity:56/154 - (36%)
Similarity:75/154 - (48%) Gaps:21/154 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    55 VNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDT------GPDYYRDMDIQYHGVEA 113
            ::.:.|.|.:...|..:..| :.|.|.:.|:|.|...  .||      .|.|.|.|        |
  Fly    44 LSRITPSLILCGAAAVVPAY-MDKLGVSCVINVAPEL--PDTPLPSQKNPLYLRIM--------A 97

Human   114 DDLPTFDLSVFFYPAAAFIDRA-LSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQV 177
            .|....||:..|..||..|:.. ||...:  |:|||.|.||||:|.|||||.|..|:|.:|.:.|
  Fly    98 QDRSEVDLAKHFDEAADLIEEVHLSGGCT--LIHCVAGVSRSASLCLAYLMKHAGMSLREAYKHV 160

Human   178 AKNR-CVLPNRGFLKQLRELDKQL 200
            ...| .|.||.||.:|||..::||
  Fly   161 QAIRPQVRPNSGFFQQLRRYEQQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP29NP_001003892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
DUPD1 45..201 CDD:350423 56/154 (36%)
CG15528NP_651767.2 DUSP14-like 44..179 CDD:350364 53/147 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.