DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP29 and ssh

DIOPT Version :10

Sequence 1:NP_001003892.1 Gene:DUSP29 / 338599 HGNCID:23481 Length:220 Species:Homo sapiens
Sequence 2:NP_733063.1 Gene:ssh / 42986 FlyBaseID:FBgn0029157 Length:1193 Species:Drosophila melanogaster


Alignment Length:282 Identity:71/282 - (25%)
Similarity:108/282 - (38%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


Human     2 TSGEVKTSLKNAYSS-------AKRLSPKMEE-----EGEEEDYCTPGAFELERLFWKGSPQYTH 54
            |...:|..||....|       :|.:..::||     .||.:.:     .:.|.|...|  |...
  Fly   327 TESVIKMKLKAIMMSVDLDEVTSKYIRGRLEEILDMDLGEYKSF-----IDAEMLVILG--QMDA 384

Human    55 VNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMD------IQYHGVEA 113
            ..:::..:|:|.|..|.:...|||.|..|:||..             |::|      .:|..|..
  Fly   385 PTKIFEHVYLGSEWNASNLEELQKNGVRHILNVT-------------REIDNFFPGTFEYFNVRV 436

Human   114 DDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVA 178
            .|....:|..::.....:|.||.::. ||:||||.||.||||::|:||.|.........|::.|.
  Fly   437 YDDEKTNLLKYWDDTFRYITRAKAEG-SKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVK 500

Human   179 KNR-CVLPNRGFLKQLRELDKQL--VQQRRRSQRQ------------------------------ 210
            |.| |:.||:.||.||......|  ::.:.:.||.                              
  Fly   501 KRRSCIKPNKNFLNQLETYSGMLDAMKNKEKLQRSKSETNLKSTKDARLLPGSEPTPLIQALNQA 565

Human   211 ------------DGEEEDGREL 220
                        |||||||..:
  Fly   566 KSKSTGEAGVTPDGEEEDGSRM 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP29NP_001003892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 8/38 (21%)
DUPD1 45..201 CDD:350423 50/164 (30%)
sshNP_733063.1 SSH-N 21..313 CDD:212166
DEK_C 326..379 CDD:462592 12/56 (21%)
DSP_slingshot 385..523 CDD:350363 47/151 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.