DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP29 and Mkp3

DIOPT Version :10

Sequence 1:NP_001003892.1 Gene:DUSP29 / 338599 HGNCID:23481 Length:220 Species:Homo sapiens
Sequence 2:NP_001262031.1 Gene:Mkp3 / 40081 FlyBaseID:FBgn0036844 Length:497 Species:Drosophila melanogaster


Alignment Length:161 Identity:53/161 - (32%)
Similarity:79/161 - (49%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    52 YTHVN------EVWP-KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPD----YYRDMD 105
            ::|.|      |:.| .|::|:...:.|...|:|....:|||..         ||    :....|
  Fly   206 HSHHNYNEAPVEIIPGLLFLGNATHSCDSEALKKYNIKYVLNVT---------PDLPNKFKESGD 261

Human   106 IQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTL 170
            |:|..:...|..:.||::.|..|..||:.|.|.. |.:||||:.|.|||.|:.|||||..:.::|
  Fly   262 IKYLQIPITDHYSQDLAIHFPDAIQFIEEARSAS-SVVLVHCLAGVSRSVTVTLAYLMHTRGLSL 325

Human   171 VDAIQQVAKNR-CVLPNRGFLKQLRELDKQL 200
            .||...|...: .|.||..|::||...:.||
  Fly   326 NDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP29NP_001003892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
DUPD1 45..201 CDD:350423 53/161 (33%)
Mkp3NP_001262031.1 DSP_MapKP 8..148 CDD:238723
DSP_MKP_classII 215..352 CDD:350414 49/146 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.