DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h2 and YGR026W

DIOPT Version :9

Sequence 1:NP_001162894.1 Gene:Kr-h2 / 33859 FlyBaseID:FBgn0266449 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_011540.3 Gene:YGR026W / 852910 SGDID:S000003258 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:44/202 - (21%)
Similarity:75/202 - (37%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IDSALWALRLLVIFFTVSYVLPIF--------TSQQSAFSKVMLANAAISALRLHQRLPAFAFSR 106
            |.|..|.::||.....|.|.|.:.        |.||:........|..:|:...|..|.|     
Yeast    74 IQSKRWYMKLLSWSPQVMYRLSLIGVFMSESVTMQQNWVGLNPTWNDLLSSENFHTLLIA----- 133

  Fly   107 EFLARLFAEDSCHYMMYSLIFFNIRPSLLVLIPVLLYSVLHASSYSLKLLDLIGQNSWWGARFII 171
                       |      |.||....|...::|.::.|.||.:..:.:|      |:....:..:
Yeast   134 -----------C------LWFFGGGKSFYKILPYMILSYLHLTKMNYEL------NANKEEKIPL 175

  Fly   172 SIVEFQAANILKATAFCEIFIMPYAIVLAFMNHAGLMTPVIY--YHYLVMRYSSRRNPYPRNAFA 234
            :..:.:..::|..:....|..:....:|.....:|.|. |||  .::|.:.:|    ||.:.|..
Yeast   176 TPKDRKMLHLLAYSELLVILALTLDTILFKTGTSGFML-VIYVGIYWLRLNFS----PYAQVAVL 235

  Fly   235 ELRITFE 241
            ||.:.||
Yeast   236 ELLVKFE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h2NP_001162894.1 UPF0121 39..268 CDD:281636 44/202 (22%)
YGR026WNP_011540.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12703
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.