DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h2 and PER33

DIOPT Version :9

Sequence 1:NP_001162894.1 Gene:Kr-h2 / 33859 FlyBaseID:FBgn0266449 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_013165.1 Gene:PER33 / 850753 SGDID:S000004054 Length:273 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:54/245 - (22%)
Similarity:101/245 - (41%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 WAL-RLLVIFFTVSYVLPIFTSQQ---SAFSKVMLANAAISALRLHQRLPA------FAFSREFL 109
            |.: ..|.||..:.:.|.| ||:|   |.:.:.:...:...|:.|:|...:      |...|:.:
Yeast    27 WFIGHFLTIFNFIQFHLSI-TSKQNQLSCYRRSLFYISVTYAIVLYQFFKSDQLKFNFTLLRQEM 90

  Fly   110 ARLFAEDSCHY-----MMYSLIFFNIRPSLLVLIPVLLYSVLHASSY----SLKLLDLIGQN--S 163
            .:|   |:..|     :::.|..|||..|..:..|| ::|:.|..:|    .|..|.||..|  :
Yeast    91 KKL---DNLQYFAMLFILFLLSQFNIIISGSLYSPV-IFSIFHFLNYFKENLLPFLPLIPLNLKN 151

  Fly   164 WWGARFIISIVEFQAANILKATAF---C----EIFIMPYAIVLAFMNHAGLMTPVI--------Y 213
            ...::..:.|..:....:..|..|   |    .:|::|:...|..:..|.:...|:        |
Yeast   152 LLNSKITVFIQNYNGFFLQMAQVFEIICGLRVGLFLVPFNFFLLLVRRANVSFEVVGTMLAGLTY 216

  Fly   214 YHYLVMRYSSRRNPYPRNAFAELRITFEALAARS-PPAFAKIIRGGIGFV 262
            ..:..:||....:  .|..|.:..:..:|..:|: ||..:::..|...||
Yeast   217 VWFFKLRYLQSES--MRQIFKQYVLRLDAYVSRTLPPYCSRLWNGYKNFV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h2NP_001162894.1 UPF0121 39..268 CDD:281636 54/245 (22%)
PER33NP_013165.1 UPF0121 24..264 CDD:397636 52/243 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4002
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004962
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104324
Panther 1 1.100 - - O PTHR12703
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.