DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h2 and TMEM33

DIOPT Version :9

Sequence 1:NP_001162894.1 Gene:Kr-h2 / 33859 FlyBaseID:FBgn0266449 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_060596.2 Gene:TMEM33 / 55161 HGNCID:25541 Length:247 Species:Homo sapiens


Alignment Length:235 Identity:104/235 - (44%)
Similarity:144/235 - (61%) Gaps:8/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AKLLQHFQTNRIDSALWALRLLVIFFTVSYVLPIFTSQQSA--FSKVMLANAAISALRLHQRLPA 101
            |..:|...||::|:|:|..||..::.:..:|||:....::|  :.:.:||||..||||||||||.
Human    12 AGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPH 76

  Fly   102 FAFSREFLARLFAEDSCHYMMYSLIFFNIRPSLLVLIPVLLYSVLHASSYSLKLLDLIGQNSWWG 166
            |..||.|||:...||||||::|||||.|..|..:.:.||||:|:|||::|:.|:||..|.||...
Human    77 FQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDARGSNSLPL 141

  Fly   167 ARFIISIVEFQAANILKATAFCEIFIMPYAIVLAFMNHAGLMTPVIYYHYLVMRYSSRRNPYPRN 231
            .|.::..:.....||||..|..|||:||..:.:.|.....|:.|.|||.:|.:|||||||||.|.
Human   142 LRSVLDKLSANQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRT 206

  Fly   232 AFAELRITFEALAARSPPAFAKIIR----GGIGFVNRLAP 267
            .|.||||..|.:..:  ||....:|    ..|.|::||||
Human   207 LFNELRIVVEHIIMK--PACPLFVRRLCLQSIAFISRLAP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h2NP_001162894.1 UPF0121 39..268 CDD:281636 104/235 (44%)
TMEM33NP_060596.2 UPF0121 9..245 CDD:397636 104/235 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147763
Domainoid 1 1.000 193 1.000 Domainoid score I3207
eggNOG 1 0.900 - - E1_KOG4002
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10018
Inparanoid 1 1.050 193 1.000 Inparanoid score I3859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56186
OrthoDB 1 1.010 - - D1360050at2759
OrthoFinder 1 1.000 - - FOG0004962
OrthoInspector 1 1.000 - - oto88911
orthoMCL 1 0.900 - - OOG6_104324
Panther 1 1.100 - - LDO PTHR12703
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.