DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h2 and tmem33

DIOPT Version :9

Sequence 1:NP_001162894.1 Gene:Kr-h2 / 33859 FlyBaseID:FBgn0266449 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001016411.1 Gene:tmem33 / 549165 XenbaseID:XB-GENE-983353 Length:247 Species:Xenopus tropicalis


Alignment Length:234 Identity:102/234 - (43%)
Similarity:141/234 - (60%) Gaps:8/234 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQHFQTNRIDSALWALRLLVIFFTVSYVLPIFTSQQSA--FSKVMLANAAISALRLHQRLPAFAF 104
            :|....|::|:|:|..|...::.:..::|||....::|  :.:.:||||..||||||||||.|..
 Frog    15 VQFLMANKLDTAMWLSRWFTVYCSALFILPILGLHEAASFYQRALLANALTSALRLHQRLPHFQL 79

  Fly   105 SREFLARLFAEDSCHYMMYSLIFFNIRPSLLVLIPVLLYSVLHASSYSLKLLDLIGQNSWWGARF 169
            ||.|||:...||||||::|||||.|..|..:.:.||||:|:||||:|:.|:||..|.||....|.
 Frog    80 SRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHASTYTKKVLDAKGPNSVPFLRS 144

  Fly   170 IISIVEFQAANILKATAFCEIFIMPYAIVLAFMNHAGLMTPVIYYHYLVMRYSSRRNPYPRNAFA 234
            .:..:.....||||..|..|||:||..:.:.......|:.|.|||.:|.:|||||||||.|..|:
 Frog   145 FLEKLNANQQNILKFVACNEIFLMPATVFMLLSGQGSLLQPFIYYRFLTLRYSSRRNPYCRTLFS 209

  Fly   235 ELRITFEALAARSPPAFAKIIR----GGIGFVNRLAPQL 269
            ||||..|.|..:  ||....:|    ..|.|::||||.:
 Frog   210 ELRIILEHLVMK--PACPDFVRRLCLSSIAFISRLAPTM 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h2NP_001162894.1 UPF0121 39..268 CDD:281636 101/231 (44%)
tmem33NP_001016411.1 UPF0121 6..245 CDD:281636 101/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3187
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10018
Inparanoid 1 1.050 191 1.000 Inparanoid score I3750
OMA 1 1.010 - - QHG56186
OrthoDB 1 1.010 - - D1360050at2759
OrthoFinder 1 1.000 - - FOG0004962
OrthoInspector 1 1.000 - - oto102777
Panther 1 1.100 - - LDO PTHR12703
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2850
SonicParanoid 1 1.000 - - X5298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.