DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr-h2 and tmem33

DIOPT Version :9

Sequence 1:NP_001162894.1 Gene:Kr-h2 / 33859 FlyBaseID:FBgn0266449 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_998828.1 Gene:tmem33 / 327214 ZFINID:ZDB-GENE-030131-5425 Length:252 Species:Danio rerio


Alignment Length:255 Identity:104/255 - (40%)
Similarity:149/255 - (58%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NSSERSSQQQEQPQQSQSQNVPAKLLQHFQTNRIDSALWALRLLVIFFTVSYVLPIFTSQQSA-- 79
            ::.:||......||        |...|...:|::::|:|..||..::.::.::||:...|.:|  
Zfish     3 DTEQRSPPPPPPPQ--------AGAAQFLLSNKLETAMWLSRLFTVYCSIMFILPLLGPQAAANF 59

  Fly    80 FSKVMLANAAISALRLHQRLPAFAFSREFLARLFAEDSCHYMMYSLIFFNIRPSLLVLIPVLLYS 144
            :.:.:||||..||||||||||.|..||.|||:...||||||::||||..|..|..:.:.||.|:|
Zfish    60 YQRALLANALTSALRLHQRLPHFQLSRAFLAQALQEDSCHYLLYSLILVNSYPITMSIFPVFLFS 124

  Fly   145 VLHASSYSLKLLDLIGQNSWWGARFIISIVEFQAANILKATAFCEIFIMPYAIVLAFMNHAGLMT 209
            :|||::|:.|:||.:|.||....|..::.:.....||||..|..|||:||..:.:.|.....|:.
Zfish   125 LLHATTYTKKVLDTMGPNSLMFVRNFLNKLTSNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQ 189

  Fly   210 PVIYYHYLVMRYSSRRNPYPRNAFAELRITFE--ALAARSPPAFAKIIRGGIGFVNRLAP 267
            |.|||.:|.:|||||||||.|..|.||||..|  .:....|..|.::....|.||:||||
Zfish   190 PFIYYRFLTLRYSSRRNPYCRTLFTELRILLEHFVMKPSCPVFFRRMCLNSIAFVSRLAP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kr-h2NP_001162894.1 UPF0121 39..268 CDD:281636 100/233 (43%)
tmem33NP_998828.1 UPF0121 16..250 CDD:281636 101/242 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581598
Domainoid 1 1.000 193 1.000 Domainoid score I3152
eggNOG 1 0.900 - - E1_KOG4002
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10018
Inparanoid 1 1.050 193 1.000 Inparanoid score I3843
OMA 1 1.010 - - QHG56186
OrthoDB 1 1.010 - - D1360050at2759
OrthoFinder 1 1.000 - - FOG0004962
OrthoInspector 1 1.000 - - oto41167
orthoMCL 1 0.900 - - OOG6_104324
Panther 1 1.100 - - LDO PTHR12703
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2850
SonicParanoid 1 1.000 - - X5298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.