DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9154 and F33A8.4

DIOPT Version :9

Sequence 1:NP_001285662.1 Gene:CG9154 / 33858 FlyBaseID:FBgn0031777 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_496368.1 Gene:F33A8.4 / 174691 WormBaseID:WBGene00009352 Length:467 Species:Caenorhabditis elegans


Alignment Length:242 Identity:59/242 - (24%)
Similarity:99/242 - (40%) Gaps:72/242 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PADTL----AILNEF------LLERSKREAEEENQIANKTGKDAQFEEDWQLSQFWYSTETKHAL 62
            |.||:    ..:|.|      :.|..:|||.|     ..|.......|....|||::||||    
 Worm   165 PTDTVLYCKTCINVFPNKHECVCEPVEREALE-----RPTHLLPPVNEQHGESQFFFSTET---- 220

  Fly    63 RDVVRKLLAERTEDSGDFSIALLSCPSLYKDIREIHDTVHIF--EFDKRFEAY--GTDFVHYDLN 123
            .||:.|.: |:::..|   |..:..|.::::||.:|...::|  ::||||..:  ...:..|.: 
 Worm   221 LDVITKAV-EKSKVDG---ILCIGAPRIFENIRALHPEKNVFLLDYDKRFAKFFPSKQYAQYSM- 280

  Fly   124 CVGSNPDYLKEHH----------QQYD-----LIVADPPF-LSQECIAKTCEIITRLQRNQKESK 172
                    |.:|.          :.:|     |::.|||| :..|.:.|:.|         |..|
 Worm   281 --------LVDHFFDKIAEPKLMEFFDKSKSILMITDPPFGVFMEPLLKSIE---------KMKK 328

  Fly   173 VILCSGEVVEPWLTARLPVLKCSFRPEHERNLGNKFVSYANFNLDEY 219
            ..:.:|:  |..|...:.||....|         |:|.:.||.:.:|
 Worm   329 RFVSTGK--EETLFYSMIVLPIYIR---------KYVLHGNFWMSDY 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9154NP_001285662.1 N6-adenineMlase 48..216 CDD:287239 46/187 (25%)
F33A8.4NP_496368.1 N6-adenineMlase 210..361 CDD:287239 46/187 (25%)
DUF3795 404..452 CDD:289445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.