DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9154 and eef1akmt1

DIOPT Version :9

Sequence 1:NP_001285662.1 Gene:CG9154 / 33858 FlyBaseID:FBgn0031777 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_012811837.2 Gene:eef1akmt1 / 100135122 XenbaseID:XB-GENE-5860920 Length:256 Species:Xenopus tropicalis


Alignment Length:228 Identity:87/228 - (38%)
Similarity:128/228 - (56%) Gaps:33/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDDISLP---ADTLAILNEFLLERSKREAEEENQIANKTGKD------AQFEEDWQLSQFWYSTE 57
            |||..:|   :..||.|.||.       ||::.|...|.|.:      ...||||||||||||.|
 Frog    43 DDDDGVPQLSSHALAALQEFY-------AEQQQQETLKLGPEYDKFSVGSVEEDWQLSQFWYSDE 100

  Fly    58 TKHALRDVVRKLLAERTEDSGDFSIALLSCPSLYKDIREI-HDTVHI--FEFDKRFEAYGTDFVH 119
            |..:|...|.::..|...      ||.:|.||:|:.:|.: .:::|:  .|:|:||..||.|||.
 Frog   101 TALSLAKEVIEVCGENGR------IACISAPSIYQKVRGLARESLHVQLLEYDQRFAIYGDDFVF 159

  Fly   120 YDLNCVGSNPDYLKEHHQQYDLIVADPPFLSQECIAKTCEIITRLQRNQKESKVILCSGEVVEPW 184
            ||.|.....|:.|::  ..:|:::||||:||:||:..|.:.|..|.|    .|:|||:|.::|. 
 Frog   160 YDYNEPLKLPESLEQ--SSFDIVIADPPYLSEECLRNTAQTIKYLSR----GKIILCTGAIMED- 217

  Fly   185 LTARLPVLK-CSFRPEHERNLGNKFVSYANFNL 216
            |.|::..|| |.|.|:|.|:|.|:|..|:|:.|
 Frog   218 LAAQILGLKICKFIPKHTRSLANEFRCYSNYEL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9154NP_001285662.1 N6-adenineMlase 48..216 CDD:287239 68/171 (40%)
eef1akmt1XP_012811837.2 N6-adenineMlase 91..203 CDD:402029 46/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5419
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5952
Inparanoid 1 1.050 136 1.000 Inparanoid score I4449
OMA 1 1.010 - - QHG55494
OrthoDB 1 1.010 - - D1272987at2759
OrthoFinder 1 1.000 - - FOG0005156
OrthoInspector 1 1.000 - - oto104921
Panther 1 1.100 - - LDO PTHR13200
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2027
SonicParanoid 1 1.000 - - X3677
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.