DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn1 and PFD1

DIOPT Version :9

Sequence 1:NP_001285661.1 Gene:Pfdn1 / 33857 FlyBaseID:FBgn0031776 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_012356.2 Gene:PFD1 / 853260 SGDID:S000003715 Length:109 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:25/114 - (21%)
Similarity:54/114 - (47%) Gaps:12/114 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADDTRVYQSVGRMF 67
            :|.:.|:.|.|::.           |::.:...:...::..:||:|...|...| :|::|.|:.|
Yeast     7 EMTVSLRNARTQLD-----------MVNQQLAYLDRQEKLAELTKKELESYPTD-KVWRSCGKSF 59

  Fly    68 LLTDVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRELVQ 116
            :|.|......||...:.......:.|:.||.:|:.:::...|.|:.|::
Yeast    60 ILQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMK 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn1NP_001285661.1 Prefoldin_2 13..116 CDD:280154 22/102 (22%)
PFD1NP_012356.2 Prefoldin 12..109 CDD:415586 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004846
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103090
Panther 1 1.100 - - LDO PTHR20903
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5528
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.990

Return to query results.
Submit another query.