DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn1 and PFD1

DIOPT Version :9

Sequence 1:NP_001285661.1 Gene:Pfdn1 / 33857 FlyBaseID:FBgn0031776 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_850990.1 Gene:PFD1 / 815304 AraportID:AT2G07340 Length:128 Species:Arabidopsis thaliana


Alignment Length:113 Identity:31/113 - (27%)
Similarity:61/113 - (53%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADDTRVYQSVGRMFLL 69
            |...:.||.|:|.:.:|.|.|:..:..:....:..:::..||.:....|.::|..|:|:||.|:|
plant     3 DEATRAAFMEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEETNTYKSIGRTFVL 67

  Fly    70 TDVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRELVQQ 117
            .....:..:.:.:.:..:.|:..|:..||:|:|.:...|:.||||:||
plant    68 EPKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRELLQQ 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn1NP_001285661.1 Prefoldin_2 13..116 CDD:280154 26/102 (25%)
PFD1NP_850990.1 Prefoldin_2 12..114 CDD:280154 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4234
eggNOG 1 0.900 - - E1_KOG3501
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2583
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1492856at2759
OrthoFinder 1 1.000 - - FOG0004846
OrthoInspector 1 1.000 - - oto3597
orthoMCL 1 0.900 - - OOG6_103090
Panther 1 1.100 - - LDO PTHR20903
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.