DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn1 and PFD1

DIOPT Version :10

Sequence 1:NP_608992.1 Gene:Pfdn1 / 33857 FlyBaseID:FBgn0031776 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_850990.1 Gene:PFD1 / 815304 AraportID:AT2G07340 Length:128 Species:Arabidopsis thaliana


Alignment Length:113 Identity:31/113 - (27%)
Similarity:61/113 - (53%) Gaps:0/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADDTRVYQSVGRMFLL 69
            |...:.||.|:|.:.:|.|.|:..:..:....:..:::..||.:....|.::|..|:|:||.|:|
plant     3 DEATRAAFMEIQASMIELTGKLKQVQNQMRNKEGDRKRAFLTLEELRPLPEETNTYKSIGRTFVL 67

  Fly    70 TDVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRELVQQ 117
            .....:..:.:.:.:..:.|:..|:..||:|:|.:...|:.||||:||
plant    68 EPKTVLEGEQEQKLKDSEAAVASLQTSKEYLEKQVAEVENNLRELLQQ 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn1NP_608992.1 Prefoldin_1 14..112 CDD:467480 22/97 (23%)
coiled coil 14..53 CDD:467480 7/38 (18%)
coiled coil 73..112 CDD:467480 7/38 (18%)
PFD1NP_850990.1 Prefoldin_1 12..110 CDD:467480 22/97 (23%)
coiled coil 12..51 CDD:467480 7/38 (18%)
coiled coil 71..110 CDD:467480 7/38 (18%)

Return to query results.
Submit another query.