DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn1 and PFDN1

DIOPT Version :9

Sequence 1:NP_001285661.1 Gene:Pfdn1 / 33857 FlyBaseID:FBgn0031776 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_002613.2 Gene:PFDN1 / 5201 HGNCID:8866 Length:122 Species:Homo sapiens


Alignment Length:118 Identity:42/118 - (35%)
Similarity:77/118 - (65%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AQMDIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLADDTRVYQSVGRM 66
            |.:|:||||||||:|...::|.:|:.:.|::.:.:...|:...||:....:|.|:|.:|:.||||
Human     3 APVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRM 67

  Fly    67 FLLTDVQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRELVQQRK 119
            |:|...:.:...|..:|:..::.|:.||:||.:|::|:|..||.:||::..|:
Human    68 FILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARR 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn1NP_001285661.1 Prefoldin_2 13..116 CDD:280154 33/102 (32%)
PFDN1NP_002613.2 Prefoldin_2 17..117 CDD:396482 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157851
Domainoid 1 1.000 72 1.000 Domainoid score I9402
eggNOG 1 0.900 - - E1_KOG3501
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5098
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52313
OrthoDB 1 1.010 - - D1492856at2759
OrthoFinder 1 1.000 - - FOG0004846
OrthoInspector 1 1.000 - - oto90367
orthoMCL 1 0.900 - - OOG6_103090
Panther 1 1.100 - - LDO PTHR20903
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5528
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.