DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn1 and pfd-1

DIOPT Version :9

Sequence 1:NP_001285661.1 Gene:Pfdn1 / 33857 FlyBaseID:FBgn0031776 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001255540.1 Gene:pfd-1 / 178021 WormBaseID:WBGene00007443 Length:117 Species:Caenorhabditis elegans


Alignment Length:120 Identity:45/120 - (37%)
Similarity:69/120 - (57%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DIELKKAFTEMQINKLETTKKIHMIDMKCDMVKTGKQKYQLTEKGTSSLAD---DTRVYQSVGRM 66
            |.|:.|||.::|....||..:|...:..   .|...||.:::|....:|.|   :.:.|:|||||
 Worm     3 DEEISKAFRDLQFKTNETRMRIVQGEQN---KKVNYQKMRISESTKKNLVDLDENLKYYRSVGRM 64

  Fly    67 FLLTD--VQNMREDLKARQEKCDKAIELLEKKKEFLQKSLKSQEDGLRELVQQRK 119
            |||||  .:..|.:.:|:|.|  :.||.:||:|::|:|.|...|..||||:|.|:
 Worm    65 FLLTDKPAEISRHEAEAKQSK--EKIEAIEKQKDYLEKGLVEAETNLRELIQSRR 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn1NP_001285661.1 Prefoldin_2 13..116 CDD:280154 38/107 (36%)
pfd-1NP_001255540.1 Prefoldin_2 11..114 CDD:280154 38/107 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165754
Domainoid 1 1.000 59 1.000 Domainoid score I7095
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I3914
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52313
OrthoDB 1 1.010 - - D1492856at2759
OrthoFinder 1 1.000 - - FOG0004846
OrthoInspector 1 1.000 - - oto18460
orthoMCL 1 0.900 - - OOG6_103090
Panther 1 1.100 - - LDO PTHR20903
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5528
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.