DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and RDH16

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_003699.3 Gene:RDH16 / 8608 HGNCID:29674 Length:317 Species:Homo sapiens


Alignment Length:209 Identity:56/209 - (26%)
Similarity:96/209 - (45%) Gaps:25/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKED 69
            ::|...:||...|.|...||.:...||||:.....|...::||......|:...:    ||:|.:
Human    28 RDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTL----DVTKTE 88

  Fly    70 QVQSSFDWIEREL--EGADVLLNNAGI---TRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFN 129
            .|.::..|::..:  :|...|:|||||   |...||:|   .|....::|.|::|||..|.....
Human    89 SVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLT---KQDFVTILDVNLLGVIDVTLSLLP 150

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSF-NIYPATKFAITAITETYRQEFQLHSNKIRVTG 193
            .::|  ..|.|:.::|:.|...|        | ..|..:|:.:.|.:::.|:|.....  ::|..
Human   151 LVRR--ARGRVVNVSSVMGRVSL--------FGGGYCISKYGVEAFSDSLRRELSYFG--VKVAM 203

  Fly   194 ICPGAVNTNIFPEE 207
            |.||...|.:..:|
Human   204 IEPGYFKTAVTSKE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 56/209 (27%)
NADB_Rossmann 1..247 CDD:304358 56/209 (27%)
RDH16NP_003699.3 NADB_Rossmann 30..305 CDD:304358 56/207 (27%)
adh_short 30..218 CDD:278532 56/207 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.