DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and YMR226C

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:76/259 - (29%)
Similarity:133/259 - (51%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERWQNKLAVVTGASGGIGAACARAMIGAG---LRVVGLARREAKLKELRESLPREL-QANFIPRR 62
            ||...|..::||||.|||.|.|...:.|.   ::::..|||..||:||::::.:|. .|.....:
Yeast     9 ERLAKKTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKKTIDQEFPNAKVHVAQ 73

  Fly    63 CDVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREA 127
            .|:::.::::...:.:.:|.:..|:|:||||....::.|....|:.:::|.||||..:|..|:..
Yeast    74 LDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAV 138

  Fly   128 FNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVT 192
            ....:.: ..|.::.:.||||.      |..|:.:||.|:|||:.|.|::.|:|  |.:.||||.
Yeast   139 LPIFQAK-NSGDIVNLGSIAGR------DAYPTGSIYCASKFAVGAFTDSLRKE--LINTKIRVI 194

  Fly   193 GICPGAVNTNIF-------PEEIHFYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKPMGE 249
            .|.||.|.|...       .|:.....||...|...::||.::||.....:..:.:..|.|..:
Yeast   195 LIAPGLVETEFSLVRYRGNEEQAKNVYKDTTPLMADDVADLIVYATSRKQNTVIADTLIFPTNQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 76/259 (29%)
NADB_Rossmann 1..247 CDD:304358 75/255 (29%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100320
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.