DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and IRC24

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:50/204 - (24%)
Similarity:96/204 - (47%) Gaps:19/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACARAMIGAG--LRVVGLARREAKLKELRESLPRELQAN-FIPRRCDVSKE 68
            |:.::||||.|||....:.:|...  ..|.|:||.||.|    :||.||..|: |:.|..|::..
Yeast     3 KVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGL----QSLQREYGADKFVYRVLDITDR 63

  Fly    69 DQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQ----KLKEVIDTNVMGVIWCTREAFN 129
            .::::..:.|.::....|.::.|||:....:.::.||::    :.:.:.|.|...::........
Yeast    64 SRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLP 128

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGI 194
            .:|.....|:::.::|.|..:..|      .::.|..:|.|:.........|..  |:|:|...|
Yeast   129 LLKSSPFVGNIVFVSSGASVKPYN------GWSAYGCSKAALNHFAMDIASEEP--SDKVRAVCI 185

  Fly   195 CPGAVNTNI 203
            .||.|:|.:
Yeast   186 APGVVDTQM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 50/204 (25%)
NADB_Rossmann 1..247 CDD:304358 50/204 (25%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 49/203 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.