DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and rdh7

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001017189.1 Gene:rdh7 / 549943 XenbaseID:XB-GENE-1194363 Length:318 Species:Xenopus tropicalis


Alignment Length:265 Identity:61/265 - (23%)
Similarity:109/265 - (41%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKEDQ 70
            :|..::||...|.|...||.:...|:.|:.....:...::|::.....||...:    ||:....
 Frog    29 DKYVLITGCDSGFGNLLARQLDKRGIHVLAACLTDKGAQDLKKETSSRLQTVIL----DVTDSKS 89

  Fly    71 VQSSFDWIEREL--EGADVLLNNAGITRETELVTPS--NTQKLKE----VIDTNVMGVIWCTREA 127
            |.|..:|:...:  :|...|:||||::      .||  |....||    :::.|::|||..|.:.
 Frog    90 VCSVANWVSSIVGNKGLWGLVNNAGVS------VPSAPNEWLTKEDFLKILNVNLLGVIDVTIKL 148

  Fly   128 FNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVT 192
            ...:::  .:|.|:.:.||||.  |.|..     ..|..:|:.:.:.:::.|.|.....  ::|.
 Frog   149 LPQVRK--AKGRVVNVASIAGR--LTFCG-----GGYCMSKYGVESFSDSLRHEMAPFG--VKVC 202

  Fly   193 GICPGAVNTNI----------------FPEEI------HFYVK-------DMARLEPA--NIADA 226
            .:.||...|.:                .||||      .:|.|       .:||..|.  .:.|.
 Frog   203 MVEPGFFKTQVTDARLQKEHLQKIWHGLPEEIRKSYGQQYYDKYCSNVDLSLARSNPKLHLVTDC 267

  Fly   227 VMYAL 231
            :.:||
 Frog   268 MEHAL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 61/265 (23%)
NADB_Rossmann 1..247 CDD:304358 61/265 (23%)
rdh7NP_001017189.1 NADB_Rossmann 30..306 CDD:304358 61/264 (23%)
adh_short 30..221 CDD:278532 49/211 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.