DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and RDH8

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:281 Identity:70/281 - (24%)
Similarity:116/281 - (41%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACA---------RAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRR 62
            :..:::|.|.|||...|         |..:.|.:|.:|      |.:.|..:....|.......:
Human     6 RTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLG------KKETLEAAAGEALGQTLTVAQ 64

  Fly    63 CDVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTP---SNTQKLKEVIDTNVMGVIWCT 124
            .||..::.|......|:.|:   |||:||||:    .||.|   .:...::.|.|||..|.:...
Human    65 LDVCSDESVAQCLSCIQGEV---DVLVNNAGM----GLVGPLEGLSLAAMQNVFDTNFFGAVRLV 122

  Fly   125 REAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKI 189
            :.....|||| .:||:::|:|:.|.|.:.|.||      |.|:|||:....|:.  ..||....|
Human   123 KAVLPGMKRR-RQGHIVVISSVMGLQGVIFNDV------YAASKFALEGFFESL--AIQLLQFNI 178

  Fly   190 RVTGICPGAVNTNI----------------FPEEIHF----YVKDMARL------EPANIADAVM 228
            .::.:.||.|.|..                .||.:|:    |:....:|      .|.::..|::
Human   179 FISLVEPGPVVTEFEGKLLAQVSMAEFPGTDPETLHYFRDLYLPASRKLFCSVGQNPQDVVQAIV 243

  Fly   229 YALRT--PPHVQVHEITIKPM 247
            ..:.:  ||..:...|...|:
Human   244 NVISSTRPPLRRQTNIRYSPL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 70/281 (25%)
NADB_Rossmann 1..247 CDD:304358 69/279 (25%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 69/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.