DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and dhrs11

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_012816490.1 Gene:dhrs11 / 496708 XenbaseID:XB-GENE-6048420 Length:255 Species:Xenopus tropicalis


Alignment Length:259 Identity:106/259 - (40%)
Similarity:151/259 - (58%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQA-----NFIP 60
            ||||:.::|:|||||.|||||.||.::..|::|||.||...|:    |.|..|.|:     ...|
 Frog     1 MERWKGRVALVTGASVGIGAAVARVLVQHGMKVVGCARSVDKI----EKLAAECQSAGYPGTLFP 61

  Fly    61 RRCDVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTR 125
            .:||:|.|:::.|.|..|:...:|.||.:||||:.|...|:: ..|:..:.:||.||:.:..|||
 Frog    62 YKCDLSNEEEILSMFSAIKTLHQGVDVCINNAGLARPEPLLS-GKTEGWRTMIDVNVLALSICTR 125

  Fly   126 EAFNNMKRRG-GEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKI 189
            ||:.:||.|. .:||::.|||:.||    ........:.|.|||..:||:||..|||.:...:.|
 Frog   126 EAYQSMKERNIDDGHIININSVLGH----IYQCAKQAHFYCATKHTVTALTEAIRQELRELKSHI 186

  Fly   190 RVTGICPGAVNTNIF-------PEEIHFYVKDMARLEPANIADAVMYALRTPPHVQVHEITIKP 246
            |||.|.||.|.|...       |.......|.:..|:|.:||:||:|||.|||||||||:.::|
 Frog   187 RVTSISPGLVETEFAYRCFENDPSIAATLYKSIKCLDPGDIANAVLYALGTPPHVQVHEMIVRP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 106/259 (41%)
NADB_Rossmann 1..247 CDD:304358 106/259 (41%)
dhrs11XP_012816490.1 Mgc4172-like_SDR_c 1..251 CDD:187601 106/259 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 152 1.000 Domainoid score I4278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133750
Inparanoid 1 1.050 162 1.000 Inparanoid score I4110
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190834at2759
OrthoFinder 1 1.000 - - FOG0000588
OrthoInspector 1 1.000 - - otm47935
Panther 1 1.100 - - O PTHR43115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 1 1.000 - - X367
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.