DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG7601

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:285 Identity:71/285 - (24%)
Similarity:122/285 - (42%) Gaps:72/285 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WQ------------NKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRES------- 49
            ||            .|:.::||||.|:|.:.|.....||.||:..|||..:|:.:::.       
  Fly    39 WQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVD 103

  Fly    50 -------LPREL-QANFIPRRCDVSKEDQVQSSFDWIEREL---EGADVLLNNAGITRETELVTP 103
                   ||.:| :.|.||               :::.|.|   ...|:|:||.||:...::.:.
  Fly   104 PAYPPTVLPLDLAELNSIP---------------EFVTRVLAVYNQVDILINNGGISVRADVAST 153

  Fly   104 SNTQKLKEVIDTNVMGVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATK 168
            :....|| |:..|..|.:..|:....:|.:| |.||:..|:|:.|    .|  .:|....|.|:|
  Fly   154 AVDVDLK-VMVVNYFGSVALTKALLPSMVKR-GSGHICFISSVQG----KF--AIPQRAAYSASK 210

  Fly   169 FAITAITETYRQEFQLHSNK-IRVTGICPGAVNTNI-----------FPEEIHFYVKDMARLEPA 221
            .|:.|..::.|.|.   :|| |.|:.:.||.:.|.:           :.:......|.|:   |.
  Fly   211 HAMQAFADSLRAEV---ANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMS---PD 269

  Fly   222 NIADAVMYA-LRTPPHVQVHEITIK 245
            .:|:.::.. ||..|.:.|.::..|
  Fly   270 KLAERILQCILRKEPDIIVSDVQAK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 71/285 (25%)
NADB_Rossmann 1..247 CDD:304358 71/285 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 69/273 (25%)
PRK06181 53..314 CDD:235726 69/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.