DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG12171

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:247 Identity:71/247 - (28%)
Similarity:109/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACA--RAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRC 63
            |..:::|:.:|||||.||||..:  .|.:|..|.:||  |...||.|..|.:.....|..:....
  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVG--RNLDKLNETAEQIVAAGGAPALQVAA 63

  Fly    64 DVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNT--QKLKEVIDTNVMGVIWCTRE 126
            |::.|..||........:....|||:|||||   .||.:..||  ::...|::|||..:...|..
  Fly    64 DINSESDVQGIVSATLAKHGRIDVLVNNAGI---LELGSIENTSLEQFDRVMNTNVRSLYQLTHL 125

  Fly   127 AFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRV 191
            ....:.:.  :|:::.::|:.|      |...|....|..:|.|:...|.....|  |....:||
  Fly   126 VTPELIKT--KGNIVNVSSVNG------IRSFPGVLAYNVSKAAVDQFTRCVALE--LAPKGVRV 180

  Fly   192 TGICPGAVNTNI-----FPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQ 238
            ..:.||.:.|.:     ..:|.  |||   .||.|.    |.:||..|..|:
  Fly   181 NSVNPGVIITELQRRGGLDQEA--YVK---FLEHAK----VTHALGRPGEVK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 71/247 (29%)
NADB_Rossmann 1..247 CDD:304358 71/247 (29%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 70/246 (28%)
NADB_Rossmann 4..254 CDD:304358 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435092
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.