DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG12171

DIOPT Version :10

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:247 Identity:71/247 - (28%)
Similarity:109/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACA--RAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRC 63
            |..:::|:.:|||||.||||..:  .|.:|..|.:||  |...||.|..|.:.....|..:....
  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVG--RNLDKLNETAEQIVAAGGAPALQVAA 63

  Fly    64 DVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNT--QKLKEVIDTNVMGVIWCTRE 126
            |::.|..||........:....|||:|||||   .||.:..||  ::...|::|||..:...|..
  Fly    64 DINSESDVQGIVSATLAKHGRIDVLVNNAGI---LELGSIENTSLEQFDRVMNTNVRSLYQLTHL 125

  Fly   127 AFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRV 191
            ....:.:.  :|:::.::|:.|      |...|....|..:|.|:...|.....|  |....:||
  Fly   126 VTPELIKT--KGNIVNVSSVNG------IRSFPGVLAYNVSKAAVDQFTRCVALE--LAPKGVRV 180

  Fly   192 TGICPGAVNTNI-----FPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQ 238
            ..:.||.:.|.:     ..:|.  |||   .||.|.    |.:||..|..|:
  Fly   181 NSVNPGVIITELQRRGGLDQEA--YVK---FLEHAK----VTHALGRPGEVK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 Rossmann-fold NAD(P)(+)-binding proteins 1..247 CDD:473865 71/247 (29%)
CG12171NP_649563.1 Rossmann-fold NAD(P)(+)-binding proteins 4..254 CDD:473865 70/244 (29%)

Return to query results.
Submit another query.