DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG31549

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:121/260 - (46%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACA--RAMIGAGLRVVGLARREAKLKELRESL-------PRELQA 56
            |..:::|:.:|||||.||||:.|  .|.:|..|.:||  |.|.||||..:::       |.||||
  Fly     1 MSSFKDKVIIVTGASSGIGASAAVHLAKLGGLLVIVG--RNEEKLKETADNIVAAGGATPLELQA 63

  Fly    57 NFIPRRCDVSKEDQVQSSFDWIERELEGA--------DVLLNNAGITRETELVTPSNTQKLKEVI 113
                   |::||.:||        ::.||        |||:|||||. ||..:..::.::...::
  Fly    64 -------DMTKEAEVQ--------QIVGATLAKHGRIDVLVNNAGIL-ETGSIEATSLEQFDRLM 112

  Fly   114 DTNVMGVIWCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETY 178
            :|||..:...|..|...:.:.  :|:::.::|:.|      :...|....|..:|.|:...|...
  Fly   113 NTNVRSLYQLTMLATPELVKT--KGNIVNVSSVCG------LRAFPGVLAYNVSKAAVDQFTACI 169

  Fly   179 RQEFQLHSNKIRVTGICPGAVNTNI-----FPEEIHFYVKDMARLEPANIADAVMYALRTPPHVQ 238
            ..|  |....:||..:.||.:.|:|     ..||.  |.|.:...:       :.:||..|..|:
  Fly   170 ALE--LAPKGVRVNAVNPGVIVTDIHKRGGMDEET--YAKFLEHCK-------ITHALGRPGDVK 223

  Fly   239  238
              Fly   224  223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 74/260 (28%)
NADB_Rossmann 1..247 CDD:304358 74/260 (28%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 73/257 (28%)
fabG 4..251 CDD:235975 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.