DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and hsd17b1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_991147.2 Gene:hsd17b1 / 402842 ZFINID:ZDB-GENE-040901-5 Length:293 Species:Danio rerio


Alignment Length:229 Identity:67/229 - (29%)
Similarity:107/229 - (46%) Gaps:39/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMI---GAGLRVVGLARREAKLKELRESLPRELQANFIP-RRCDV 65
            :.|:.::||.|.|||.:.|..:.   ....:|....|...|.:.|.||: |.|..:.:. .:.||
Zfish     2 EQKVVLITGCSSGIGLSLAVHLASNPAKAYKVYATMRNLDKKQRLLESV-RGLHKDTLDILQMDV 65

  Fly    66 SKEDQVQSSFDWIERELEG-ADVLLNNAGITRETELVTPSNTQKL---KEVIDTNVMGVIWCTRE 126
            :  || ||..|......|| .|:|:.|||:    .|:.|..|..|   :.::|.|::|.|...:.
Zfish    66 T--DQ-QSILDAQRNVSEGRIDILVCNAGV----GLMGPLETHSLDTIRAILDVNLLGTIRTIQT 123

  Fly   127 AFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYR---QEFQLHSNK 188
            ...:||:: ..|.:|:..|:.|.|.|.|.:|      |.|:||||....|:..   |.|.:|.:.
Zfish   124 FLPDMKKK-RHGRILVTGSMGGLQGLPFNEV------YCASKFAIEGACESLAILLQHFNIHISL 181

  Fly   189 IRVTGICPGAVNTNIFPEEIHFYVKDMARLEPAN 222
            |.    | |.|||:        ::.::.|.||.:
Zfish   182 IE----C-GPVNTD--------FLMNLKRTEPGD 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 67/229 (29%)
NADB_Rossmann 1..247 CDD:304358 67/229 (29%)
hsd17b1NP_991147.2 SDR 4..257 CDD:330230 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.