DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and rdh8b

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_957082.2 Gene:rdh8b / 393761 ZFINID:ZDB-GENE-040426-1759 Length:317 Species:Danio rerio


Alignment Length:253 Identity:70/253 - (27%)
Similarity:116/253 - (45%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACA---------RAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRR 62
            |:.::||.|.|||...|         |..:.|.:|  .|.|::..:....::..:.|..      
Zfish     7 KVVLITGCSSGIGLGIAVMLARDKQQRYYVIATMR--DLKRQDKLVCAAGDTYGKTLTV------ 63

  Fly    63 C--DVSKEDQVQSSFDWI-ERELEGADVLLNNAGITRETELVTP---SNTQKLKEVIDTNVMGVI 121
            |  ||...:.|:...|.: :|.:   |:|:||||:    .||.|   .:...:.:|.:||..|.:
Zfish    64 CTLDVCSNESVRQCVDSVKDRHI---DILINNAGV----GLVGPVEGLSLDDMMKVFETNFFGAV 121

  Fly   122 WCTREAFNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHS 186
            ...:|...:||:| ..||:::|:|:.|.|.:.|.||      |.|:||||....|:.  ..||..
Zfish   122 RMIKEVMPDMKKR-RSGHIIVISSVMGLQGVAFNDV------YAASKFAIEGFCESL--AVQLLK 177

  Fly   187 NKIRVTGICPGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALRT---PPHVQVHE 241
            ..:.::.|.||.|:|..   |:..| .|:::.|..|.....|:..||   |..|.:.:
Zfish   178 FNVTMSMIEPGPVHTEF---EMKMY-DDVSKKEYPNTDPETMHHFRTCYLPTSVNIFQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 70/253 (28%)
NADB_Rossmann 1..247 CDD:304358 70/253 (28%)
rdh8bNP_957082.2 type1_17beta-HSD-like_SDR_c 7..264 CDD:187666 70/253 (28%)
adh_short 7..202 CDD:278532 62/222 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.