DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:214 Identity:52/214 - (24%)
Similarity:97/214 - (45%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPREL---QANFIPRRCDVSKEDQV 71
            :|||||.|||...|......|.::|..|||...|::: .|..||:   :|.:||  .|::.....
Zfish    37 LVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQV-VSKCREMGAQKAFYIP--ADMANPSDA 98

  Fly    72 QSSFDWIERELEGADVL-LNNAGITRETELVTPS-------NTQKLKEVIDTNVMGVIWCTREAF 128
            .....:...:|.|.|.| ||:.|         ||       :.|..:.:::.|.:..:...::|.
Zfish    99 DLVVKYAIEQLGGLDYLVLNHIG---------PSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKAL 154

  Fly   129 NNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTG 193
            ..:::  .:|.:::::|:.|.....|  .||    |.:||||:.......:.|..:..:.:.:|.
Zfish   155 PTLEK--SKGSIVVVSSLLGKICGPF--ALP----YASTKFALNGFFGGLQNELAMQKSNVSITI 211

  Fly   194 ICPGAVNTNIFPEEIHFYV 212
            ...|.::|:...|:|..|:
Zfish   212 CILGLIDTDSAMEKIKGYI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 52/214 (24%)
NADB_Rossmann 1..247 CDD:304358 52/214 (24%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 52/214 (24%)
adh_short 36..229 CDD:278532 51/211 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.