DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG10672

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:98/224 - (43%) Gaps:18/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPRRCDV 65
            |:|...|:||||.::.|||.|.|:.:...|..||..:|::..:......| |:|..|....:|.|
  Fly    66 MKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNVDSALAEL-RKLNLNVHGLKCHV 129

  Fly    66 SKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130
            |:.:..:..|:....:....::|::||........|...:.:...::.|.||.......:||. .
  Fly   130 SEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEAL-P 193

  Fly   131 MKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGIC 195
            :.|:.....::.::||||:      |.......|..:|.|:..:|:...::  |....|||..:.
  Fly   194 LLRQQKNSSIVFVSSIAGY------DAFELLGAYSVSKTALIGLTKAAAKD--LAPEGIRVNCLA 250

  Fly   196 PGAVNTNIFPEEIHFYVKDMARLEPANIA 224
            ||.:.|.        :.|.:...|.||.|
  Fly   251 PGVIRTK--------FSKALYENESANEA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 55/224 (25%)
NADB_Rossmann 1..247 CDD:304358 55/224 (25%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 54/223 (24%)
fabG 67..316 CDD:235975 54/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.