DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and HSD11B1L

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:235 Identity:54/235 - (22%)
Similarity:101/235 - (42%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPRELQANFIPR----RCDV 65
            |....::|||:.|:|...|......|..:|..|..||.|:::..:. |:|.|   |:    ..|:
Human    75 QGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNC-RKLGA---PKVFYIAADM 135

  Fly    66 SKEDQVQSSFDWIERELEGADVLLNN--AGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAF 128
            :..:..:|...:...:|.|.|.|:.|  .|....|...:|..|:.|.:|   |.:..:..|..|.
Human   136 ASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSPQATRWLMQV---NFVSYVQLTSRAL 197

  Fly   129 NNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNI-YPATKFAITAITETYRQEFQLHSNKIRVT 192
            .::  ...:|.:::::|:.|.       |..||:. |.|.|||:.....:.|:|..:....:.:|
Human   198 PSL--TDSKGSLVVVSSLLGR-------VPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAIT 253

  Fly   193 GICPGAVNTNIFPEEIHFYVKDMARLEPANIADAVMYALR 232
             :|...:.......|.   |:.:.|::.|....|.:..:|
Human   254 -MCVLGLRDRASAAEA---VRGVTRVKAAPGPKAALAVIR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 54/235 (23%)
NADB_Rossmann 1..247 CDD:304358 54/235 (23%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 54/235 (23%)
PRK08251 78..302 CDD:181324 53/232 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.