DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and HSD11B1

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:204 Identity:50/204 - (24%)
Similarity:94/204 - (46%) Gaps:17/204 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERWQNKLAVVTGASGGIGAACARAMIGAGLRVVGLARREAKLKELRESLPREL---QANFIPRRC 63
            |..|.|..:|||||.|||...|..:...|..||..||.:..|::: .|...||   .|::|....
Human    30 EMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKV-VSHCLELGAASAHYIAGTM 93

  Fly    64 -DVSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREA 127
             |::..:|..:.   ..:.:.|.|:|:.| .||..:..:...:...:::.::.|.:..:..|..|
Human    94 EDMTFAEQFVAQ---AGKLMGGLDMLILN-HITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAA 154

  Fly   128 FNNMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVT 192
            ...:|:  ..|.:::::|:||..      ..|....|.|:|||:.....:.|:|:.:....:.:|
Human   155 LPMLKQ--SNGSIVVVSSLAGKV------AYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSIT 211

  Fly   193 GICPGAVNT 201
            ....|.::|
Human   212 LCVLGLIDT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 50/204 (25%)
NADB_Rossmann 1..247 CDD:304358 50/204 (25%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.