DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9150 and CG31548

DIOPT Version :9

Sequence 1:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:204 Identity:57/204 - (27%)
Similarity:100/204 - (49%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLAVVTGASGGIGAACA--RAMIGA-----GLRVVGLARREAKLKELRESLPRELQANFIPRRCD 64
            |:.::||||.|||||.|  .|..||     |..|..|.:..|:..::.:|.|..:..       |
  Fly     6 KVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQSQPALVVG-------D 63

  Fly    65 VSKEDQVQSSFDWIERELEGADVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFN 129
            ::||...|..:....::....|||:|||||. ||..:..::.::...|::||:..:...|..|..
  Fly    64 IAKEADTQRIWSETLQQYGKLDVLVNNAGII-ETGTIETTSLEQYDRVMNTNLRAIYHLTMLATP 127

  Fly   130 NMKRRGGEGHVLIINSIAGHQVLNFIDVLPSFNIYPATKFAITAITETYRQEFQLHSNKIRVTGI 194
            .:.:.  :|:::.::|:.|  :.:|..|| ::||   :|..:...|.....|  |.:..:||..:
  Fly   128 ELVKT--KGNIVNVSSVNG--IRSFPGVL-AYNI---SKMGVDQFTRCVALE--LAAKGVRVNCV 182

  Fly   195 CPGAVNTNI 203
            .||...||:
  Fly   183 NPGVTVTNL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9150NP_608991.2 YdfG 1..251 CDD:226674 57/204 (28%)
NADB_Rossmann 1..247 CDD:304358 57/204 (28%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 57/204 (28%)
NADB_Rossmann 3..253 CDD:304358 57/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.